ECF proteins of ECF subgroup ECF62s2

Displaying all 14 ECF
Name Aliases LCA Taxa Group Subgroup
ECFp76760
Gemmata sp. SH-PL17 ECF62 ECF62s2

>ECFp76760 ECF62 ECF62s2 Gemmata sp. SH-PL17

1 MAEPPLTRVTLLTRLRDGRDADAWREFVQLYGPVVYRFARNRGLQDADAA
51 DLMQDVLRSVARNAHRMEYDPKRGTFRGWLYTVTRNKIYNFLSSQRNRPR
101 GTGDADAQERLDATPAREEEGPDADWEKEYQRRLSARAMELVRGEFQPNT
151 WAAFWQTAVEGKSAAEVGTELKMSPGAVYVAKSRVLARLRDEVQKIMVEE
201 DAA

>ECFp76775 ECF62 ECF62s2 Planctopirus hydrillae

1 MDRVLQNSPITRVSLLIRLRDAADHSAWQQFAELYGPVIYRFARGRGLQD
51 ADAADVMQDTLRSVSNAIGRLDYDSAKGSFRGWLFTIARNKIFNLLSSRK
101 NKPRAAGDTAAHELLQATPSDDNSLEESWEDEYRRRLAGIAIERIKGEFQ
151 PNTWEAFWGTAVNGESATDVGERLGMSSGAVYVAKSRVLARLKEQVQRLI
201 DEEDQ

Name Aliases LCA Taxa Group Subgroup
ECFp76743
  • extracytoplasmic function alternative sigma factor
  • RMSM_06978
Rhodopirellula maiorica SM1 ECF62 ECF62s2

>ECFp76743 ECF62 ECF62s2 Rhodopirellula maiorica SM1

1 MLSSSKAAQDSNLTDSPITRATLLLRLRDGEDNEAWAEFLRDYGPMLYRF
51 ARSRGLQDADAADIVQDVIRRVGSAISRLDYAKEKGGFRAWLFTITRNRL
101 YTYFEKRKRLGPTANDTAQYEMLSQAPQASNELHEAWEREHQRQLAGQAM
151 KEVEPEVEPQTWKAFLMTAVDGISAGDAAKQLGMTTGAVYVAKSRVIARL
201 KTVIERLQQEDQ

>ECFp146583 ECF62 ECF62s2 Mariniblastus fucicola

1 MADIKLTRASLVFRLRDRSDDEAWKQFVDLYGPMIFRFLRSRGLQDADAA
51 DLLQEVLRRVGDSIGKLDYAKSKGGFRAWLFTITRNCLNSFFEKRKRTKT
101 TGNDSTHNAFLNQLPNDTEELTEIWEKEYQRQLMSKAIAIVRPNTDSKTW
151 AAFEMTAINNMTADEAGDALEMTRGAVYVARSRVTARLRAEVERLMEEEE

Name Aliases LCA Taxa Group Subgroup
ECFp2685
  • RNA polymerase sigma factor, sigma-70 family
  • Plim_0986
Planctopirus limnophila DSM 3776 ECF62 ECF62s2

>ECFp2685 ECF62 ECF62s2 Planctopirus limnophila DSM 3776

1 MLQNSPITRVSLLLRLRDTADHSAWQQFAELYGPVIYRFARGRGLQDADA
51 ADVMQDTLRSVSNAIGRLDYDSAKGSFRGWLFTIARNKIFNLLSSRKNKP
101 RAAGDTAAHELLQATPSDDNSLEESWEDEYRRRLAGIAIERIKGEFQPNT
151 WEAFWGTAVNGESATDVGERLGMSSGAVYVAKSRVLARLKEQVQRLIDEE
201 DQ

Name Aliases LCA Taxa Group Subgroup
ECFp2692
  • sigma factor
  • GEMOB_RS26050
Gemmata obscuriglobus UQM 2246 ECF62 ECF62s2

>ECFp2692 ECF62 ECF62s2 Gemmata obscuriglobus UQM 2246

1 MSEPPLTRVTLLARLKDGRDTGAWSEFVQLYGPVVYRFARNRGLQDADAA
51 DLMQDVMRSVARNAHRMEYDPKRGTFRGWLYTVTRNKIYNFLSSQKNRPR
101 GTGDADAQERLDATPAREEEGPDADWEKEYQRGLSARAMELVRSEFQPNT
151 WAAFWQTAVEGKSAAEVGTGLKMSSGAVYVAKSRVLARLRDEVQKMIAEE
201 S

>ECFp76733 ECF62 ECF62s2 Planctomycetaceae bacterium SCGC AG-212-F19

1 MAEAPVTRASLLVRLRDPQDHDAWQQFFRVYASVVYGFARRRGLQDADAA
51 DLMQDVLRRVALAAGKLDYDPRKGTFRSWLFTVTRNRLFDFLNSRQRQVA
101 GAGGSDGQRRLDEQPATPDPADGAGSWDQEYHQGVLRWAMERVRGEFQEN
151 TWQAFRQTAVEGKNPKEVAGSLKMSPGAVYVAKSRVLARLKTEVRQWQDD

Name Aliases LCA Taxa Group Subgroup
ECFp76740
  • hypothetical protein
  • BGIM_RS0106645
Zavarzinella formosa DSM 19928 ECF62 ECF62s2

>ECFp76740 ECF62 ECF62s2 Zavarzinella formosa DSM 19928

1 MSAPPLTRASLLVRLRDPNDVSAWKEFVQLYASIIYGFARKRGLQDADAA
51 DLMQEVLRSVSSAMGRLNYDPAKGTFRGWLYSITRNKIYTFLESRARQAR
101 AAGDSNSQQRLEELPNRPGDTDDWDKEYERKSFAWAAERVKHEFQPATWK
151 AFWKTAVDGESPKDVGRELGMSPGAVYVAKSRVIARLRDEISQLNPD

>ECFp76746 ECF62 ECF62s2 Rhodopirellula sp. SWK7

1 MTETPLTRATLLLRLRDTADTEAWEAFLRDYGPMLYRFIRSRGLQDADAA
51 DVVQDVLRSVGMAIDRFDYAKEKGGFRAWLFTITRNKLSTYFEKRKRASP
101 TANDTAQLELLKQESAGKDELEESWDREHQRQIAAKAMRLLQPTIEPNTW
151 MAFTMTAVDGMTAEDVATRLSMSKGAVYVARSRVTAKLRNEVARILAEED
201 AGELV

Name Aliases LCA Taxa Group Subgroup
ECFp76753
Roseimaritima ulvae ECF62 ECF62s2

>ECFp76753 ECF62 ECF62s2 Roseimaritima ulvae

1 MTNSPPTRATLLLRLRDRGDAVAWNEFVRDYGPLLYRFVRSRGLQDADAA
51 DLVQDVMRRVGTGIGRLDYEKQKGGFRAWLFTITRNQLATYFEKRKQLGP
101 LGGAAAGGGSAADDVREQADNGHSSLEAQWELEYRRQLAARAMQQLKPTI
151 EPNTWAAFELTAIEGRTAQHTAERTGMSTGAVYVARSRVTAKLRDEITRL
201 LAEEEA

Name Aliases LCA Taxa Group Subgroup
ECFp76776
  • DNA-directed RNA polymerase sigma-70 factor
  • RMSM_RS32230
Rhodopirellula maiorica SM1 ECF62 ECF62s2

>ECFp76776 ECF62 ECF62s2 Rhodopirellula maiorica SM1

1 MTDSPITRATLLLRLRDGEDNEAWAEFLRDYGPMLYRFARSRGLQDADAA
51 DIVQDVIRRVGSAISRLDYAKEKGGFRAWLFTITRNRLYTYFEKRKRLGP
101 TANDTAQYEMLSQAPQASNELHEAWEREHQRQLAGQAMKEVEPEVEPQTW
151 KAFLMTAVDGISAGDAAKQLGMTTGAVYVAKSRVIARLKTVIERLQQEDQ

Name Aliases LCA Taxa Group Subgroup
ECFp76784
  • DNA-directed RNA polymerase sigma-70 factor
  • PLIM_RS05075
Planctopirus limnophila DSM 3776 ECF62 ECF62s2

>ECFp76784 ECF62 ECF62s2 Planctopirus limnophila DSM 3776

1 MDRVLQNSPITRVSLLLRLRDTADHSAWQQFAELYGPVIYRFARGRGLQD
51 ADAADVMQDTLRSVSNAIGRLDYDSAKGSFRGWLFTIARNKIFNLLSSRK
101 NKPRAAGDTAAHELLQATPSDDNSLEESWEDEYRRRLAGIAIERIKGEFQ
151 PNTWEAFWGTAVNGESATDVGERLGMSSGAVYVAKSRVLARLKEQVQRLI
201 DEEDQ

Name Aliases LCA Taxa Group Subgroup
ECFp76791
  • sigma factor
  • extracytoplasmic function alternative sigma factor
  • ... more
Rhodopirellula sallentina SM41 ECF62 ECF62s2

>ECFp76791 ECF62 ECF62s2 Rhodopirellula sallentina SM41

1 MTETPLTRATLLLRLRDAADSEAWGEFLRDYGPMLYRFIRSRGLQDADAA
51 DVVQDVLRSVGAAIGRFDYERDKGGFRAWLFTITRNKLATYYEKRIRANP
101 TAGDTAELDLLNQEPGGKDELAESWEREHQRQVAAKAMRLVEPKTEPKTW
151 KAFTMTAVNGMPADEVAAQLGMSKGAVYVSKSRVTAKLRDEVNRIIADED
201 AGELN

>ECFp76802 ECF62 ECF62s2 Planctomycetaceae bacterium SCGC AG-212-F19

1 MPDALLTRASLLVRLRDPQDRPAWEQFVELYGSVVYRFVRRRGLQDADAA
51 DLTQEVLQAVAQSMGRWQYDPAQGTFRGWLFGMTRHKIAHFLQRRQRQAI
101 GSGDTGANQRLGEAPCPEGDGESTWDQEYQEQLFRLAAEHVRPSFAPATW
151 QAFWMTAVEGKSAAEVGSALGLSVGAVYVAKSRVLARLAERVQELQAE

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more