ECF proteins of ECF subgroup ECF57s2

Displaying ECF 1 - 20 of 76 in total

>ECFp164498 ECF57 ECF57s2 Planctomycetales bacterium 71-10

1 MFGVLFAEGAIGPRSDADLLRLFTTRERETAEAAFAALIERHGPMVLGVC
51 RRTLGESHAAEDAFQAVFLVLARRAPAVRVDDSLGRWLYGVARKVASKAR
101 RRAGREIPAAAASDRTPIDPVAEVAREEVRRLVDREVALLPRKYREPAAL
151 CHLDGLTHEQAAEALGVPVGTIRSRLSRARDLLRPRLVRRGLAPAAALAR
201 LDSPAAAAALPRALSAATIAAALGAGARGVAPAAALAAATVRPAITSRVV
251 ATGAVLAVVVGGSFVLRGLGVMGQEPPAAAVARPPDAPSLDDQIRQIIRE
301 HEDEEARARKAMRGLSKAELQRWRAEGGGFPNRFNTMRRILDMVAAHPGE
351 PVGRDGLVWIVGYRSASSTGEFGDLFGRAARLLVEHFADDPEVARAGLDM
401 DNEATRGRDAFLEGIYATAVGREARGLIRYGLALYLAKKSEHARYLRDQP
451 GPQTHTSIRPGDKAGPRDEIQVPLSHERRGYHEHLRMLDPATLRARSERL
501 FEEVLAEYADIPYLTAHGRELQRKVRERPSAAIEDPQEKQDREATERWVA
551 APVPTLGEKAAEQLDELRHLVEGRPAPDVEGIGADGRPIRLSDHRGKVVV
601 LSFWNSSDLRHIADDRRLVEDLPEGRFALVGAVRWDADEGARAVVERERM
651 TWPNILKGGEAIAGRYHAPRSSAWYVIDAEGVLRGKRLMFPSGVLAIVRP
701 LIAEAGRRDD

>ECFp26242 ECF57 ECF57s2 Planctomycetaceae bacterium SCGC AG-212-F19

1 MDHRRVETILHHLRQWTGSQPALADGQLLERFAGQRDEAAFELLVRRHGP
51 LVWNVCHRLLGNAHDAEDAFQAVFLILLRKASALDRTGTVAPWLYGVACR
101 VALRARARRGRDPIPLMNEPGDHGSSNQTAELRRILDEEVNRLPERYRAP
151 VVLCYFQGRTHEEAARELHWPLGTVKCRIMRAREWLRVRLTRRGLTLASG
201 ALAAMMSAEGLRAAMPPLLIESTVAAGLAGTVPAAALAEGVLRAMFLTKL
251 AKITVSLVAVLGLGLGVAGLLGEPAAPGVAPINAAEPVLPGIAAEDTAPA
301 APASADPLAGPWADLASDDEAKALRAVLTFARDSKAAVAFFKQHLHPVLV
351 DAKRIARRIADLDSAEFAVRAQASADLENFGEYALPYLQAALEGNPPLEV
401 RQRVADLLYRLKQPRLPAGWVRSVRAIAVLEAIGGDEARTILEALARGRA
451 RAVPTQEAEVALDRLAAHFAVPVARRWGDLSSTDEARVAQALLALATRPK
501 ETLQFLQEQLKGKTLNVGVANDITERVNRLIVELGSNRFDVREKASQQLG
551 ALGQAAVPALMQAVNGPVPLPLETRRRIEELIFQARLNQRQQAIQAHAEL
601 LTGKVAGPAPQPPAPALAITAVLVQRAEVLLGHIGTREAAELLAAFKAAA
651 QIKSTRDALSSDGKLRAHIDTNGRITLSDPMTGKILSYHDGTAQCLAFAP
701 DSKLLVYGSATSTLSILETATGKLVRQIKFVPAGGIVAVSVSPDGSRLSA
751 NGADGTVAEFELATGKQLR

Name Aliases LCA Taxa Group Subgroup
ECFp26209
Gemmata sp. SH-PL17 ECF57 ECF57s2

>ECFp26209 ECF57 ECF57s2 Gemmata sp. SH-PL17

1 MSVAAVRRVISRLEPGGPRTDAELVRAIAPDGVDRESAFAELVNRHGPMV
51 LGVCRGVLADSHAAEDAFQAVFLVLARKANSIRPPGAVGGWLYGVAVRTA
101 RKSKTATVRQRRREMAAIVSAGSAPTSTGSAAPGELERAELRAIIDAELA
151 ALPDTHRAAIVLCDLQGKTRSEAALELDRAEGTVAAWLARGRKALATRLA
201 RHGVALPAAGLVAVVTPSIVSAELVSVTIGSFVGRGVSDSVLALAEGVMR
251 SLSSTPTKLVTTVLTVGVLLAVVATAPAWYAHPEPNAPPGTGAATVSGVE
301 PHAKAASSSWKEAKVLELTGWLGGSAVYSADGKVLFVGGTDGHVHAYDVV
351 SWKKLWEYRGAGHFAALAVVPDGKELAVTTKDGVMFLGALTGKANDTLEV
401 RESAPYAVAFFPDTPILSDGQLVATSRKVIFGDAREITVKSWLKWPNVST
451 ITLPVRPNGKQPSDPHAGPLAVAPDGKRVVVTGPLDKATGKNVLWAWAAG
501 SGAGNQLLEGHKATVVSAAWSKDGKWIVTGDADGIVIIWDAVKFKEKSRL
551 TLGGRVAAVAVSVDGKHTAAAVVQPQERKGKDVYSEEIFVWSTASPPKKP
601 ELISSHPVGGPFAGIASLAFHPDGTALASAFANFDHLTKLGELTGKVRVF
651 ALSVPEKPAPKPAAGHNWSQSSVLTDHAALVNGIAIAPDGKSFAAATDAN
701 VTCWDTVTRRVLWTYKPTNGNAPVLALAYSPDSKHLCVAGPTDVKRLDVE
751 TGKSAAWYDQNEIVVRFGKMHTLAYHPEGKRLAASDGYATKVQNLAQESE
801 AISIGERPEESKPLPVLPASAAWSKDGKQLALIRHKQDKSCVVLWEPGRA
851 ESEVELTGHSERITCVVWSKDGDVIASGDEKGTVILWDARTHKELWRKQY
901 GDGAGRVHAVAISPEDNTVAIAANLGARKSPERVVLLAAKDGAEIHHLLG
951 PEETAVSSLAWSSGGRFLLTGCGTPVDRAGGQAAPRVGEVVVWERKP

>ECFp26253 ECF57 ECF57s2 Planctomycetaceae bacterium SCGC AG-212-F19

1 MTDEQLLERFVSQRDAAAFEELVRRHGPMVMRVCQRALRHAQDAEDAFQA
51 TFIVLARKAHVIAKGSTASWLYGVAYRIALQTRDSANKHRAREQAVPDRA
101 LASPDQKHPGVTAEDRQALDEELHRLPEKFRAPLVLCYLEGKTTDETADQ
151 LGWSRGTVASRLSRARDRLRDRLSRRGVMLGTAAVATLLTHQVATAAVPA
201 ALGTATTNAAVAAVAGKAVGATAAAGALADSALKAMFWAKMKLYGLIMAS
251 AAVVAVPAVILLPPSDPGLVGHYAFAEGSGTSVKDASSSGNHGKLVGGVT
301 WTTGRKPGSKALSFDGQTGHVKLAQDLSRWLGSSATVAFWLNTTQRGVPS
351 DGFAVPGCVTGVDVSGNDQAVTTNDIQWGFVDETGRTGVCVGDLDLRRTK
401 QMEEILVRSKQPINDGQWHHVALTRDATLGRVAVFVDGKLSGTTLTTAIG
451 PKTSPFFSIGRKEVIPEQTKPAYHFQGLLSEVRFYNRVLKPEEIAALAQ

>ECFp182449 ECF57 ECF57s2 Singulisphaera sp. GP187

1 MAQESARKAQQQLGTLFTSGAIGGLSDDELLRRFLRQSGCDAEAAFQVLV
51 ERHGPMVMGVCRRMLSDYHAAEDAFQATFLVLARRADAASRQERLANWLY
101 GVAVRAAKELRRSEARRQARERASVDPHRAELATDQGPGQVDLHSVLDEE
151 LSRLPGRYRAALVACELEGLSRREAAVQLGVPEGTLSSHLMRGRKLLRER
201 LGRRGFGATAWSLGGLAHEGGWSSVPVSGMLTRSSVRTALGVLSGDVGSV
251 PTSVDLLINSMWRTKLVSKLVMAVGTGVSLGVLALVGVVLAQTDQGSEPH
301 TPPPRVTANPPKPPRVSSSIEGDNLRMNVEVPLDLVVPDTLILRGQGREV
351 EISVGPRLLRSMEGHTGSVFSVAFSPDGTKILSGSGWPWGDRTLRLWDVA
401 SGVEIRRFLTATDDPGAETHGPREVPGEVHSLAFTPDGRQALSGGTGGIV
451 QLWDLETGKEIRRLSGHTGTIYELAISPDGRRALTASRDKTARLWDLASG
501 REIHVLKGHTNWVRSVAFSPDGRRALTGSGPKDHTMRLWDLETGGQLKSL
551 EQAGIVRGLAFTPDGVHAIAGINPELPDVPGAIHLWDLDRGVEVRRFDGH
601 GFAVTSIAMAPDGRQFLSTSYDRTIRLWDIASGRELYRLTGHQEWVWTVA
651 YSPRGDLAVSGGGASGGAQTVAPGHDFALRLWDLTGKAEIKTAVPSLPGR
701 P

Name Aliases LCA Taxa Group Subgroup
ECFp26311
Gemmata sp. SH-PL17 ECF57 ECF57s2

>ECFp26311 ECF57 ECF57s2 Gemmata sp. SH-PL17

1 MNQNLHVIRRVTAEAMQTDGQLLDAYSDRRDGAAFAELVRRHGPMVWGVC
51 RRMLPNRQDAEDAFQATFLVLVRKSASVRPAERVGNWLHGVAVRAAQKAA
101 VAARRRERSVEGVADPAIVESGAWRDVLPILDEELSLLPDRYRSVIVLCD
151 LEQMTRTAAARRLGVPEGTVAGWLARARALLGKRLARRGVGAPALAALIS
201 ERVVSALVPAPVIRTTIEDANRAAPTPVGVATLTEGVIRTMFLKKIRSAA
251 IAVLVGLGAVASGAVLLTRPTVAAQPARTEATGATALVKPVERPAANPPE
301 NCVHVDRGLEPSAARYRALFERTLYVLVEHFGQITSANAYEGRIETRQPF
351 GNRTAVVAIRAAEEGGGYLVEVRILHEAGGGKPTGRDVDLERVILRQLAP
401 QTEIRSGDRAVPTARTGATSSSSQQQIEARPDPTTPRAQKPVESKDDQVR
451 RLQKEVDELRERVRALERRLSNRENGASPPAKDGR

Name Aliases LCA Taxa Group Subgroup
ECFp26302
Gemmata sp. SH-PL17 ECF57 ECF57s2

>ECFp26302 ECF57 ECF57s2 Gemmata sp. SH-PL17

1 MTIRIHRTVSALARMPADAFPENRHTDEELIGAFVELRAPDAFEELVRRH
51 GPMVLGVCLRVLRHRQDAEDAFQATFLVLARKAGSISPRNAAANWLHGVA
101 LQTAIRARAITMKRRKRETSVPLVPEAGVREVWWDDAAAVLDEELGHLPS
151 HYRAVVLLCDVEGRTRADTARHLGCPEGSVSSRLSRARALLARRLSRRGV
201 APPLGGLALLAGPSAAIAVPPALVKSTVEAAGSVPGASTSPAVTTLTEGV
251 LKAMLITELKTLALIALFVGFLGLGGAIGIGRSAGQQPGKPVEEKRADGP
301 KNPEVALQKEVDAAVESVKRAKKALDLAVTELHRADERLATAKRKGKPLE
351 VKPVTGKLLRSDVAERTVHVEVYKEVADSRAELWGGIIGFCGHVYETFPL
401 VPQATVLQDHVPTKLADLKEGAQVTLQLGRDGKSAESVTADGGSVRGRFV
451 SWNETRNTITVTIGAKSEPRVFHLLRACVRGAAHVKDFKPGTPLLITRSV
501 EDANTAIEIEAVAAGEDRTEPQPNQPAKRE

Name Aliases LCA Taxa Group Subgroup
ECFp26287
  • hypothetical protein
  • BGIM_RS57440
Zavarzinella formosa DSM 19928 ECF57 ECF57s2

>ECFp26287 ECF57 ECF57s2 Zavarzinella formosa DSM 19928

1 MANSRMSELVLSLRRAALSHDEAATATDGDLLGCFIERRDGVTFDALVRR
51 HGPMVWGVCRRRLPHHDAEDAFQATFLVLVRKATSIVPREMVGNWLHGVA
101 RQTALQSQRTAARRRAREATVSEMPDVGAEPPEPWSDEPFLLDQELSRLP
151 EKYRALIVLCDLEGRTRKEVARQLGAPEGTVAGRLARAREMLAKRLTRRG
201 VALSAVALAGLSQNITLAGLPNSVMISTISAATHVAAGPMTAGVISSKVA
251 ALTEGALKAMFLSKLKSMSAVLLACLMIGGAALMTFRAATGQEGDRPPVA
301 RQPKSPADKGKPVAPPPEQPKDETSPWMKEFVKAYSLADGEVLKRVSKFP
351 ECRAEYIKNSPRLVSVNSEIPISMALRVHQKETNGELHMWGFNQGDGSLF
401 GVMWQIGIPMGEVEANKQLLDTRITGDFVFRQDAPMEKLMSALEGILREE
451 CTLPVRLAFKEVEREVVVAKGTLKIKPLEGRAANHIEVYAKEAIKGSYSG
501 GGGSGDMGRFFSDLGGFVRRRIVSEATHAPNETVSYAMHVRTTPPLVPTL
551 GEDQARDAEDHEYKTVLDNVAKQTGLTFTIEKRKIRVLVVEKDGK

Name Aliases LCA Taxa Group Subgroup
ECFp26283
Gemmata sp. SH-PL17 ECF57 ECF57s2

>ECFp26283 ECF57 ECF57s2 Gemmata sp. SH-PL17

1 MRKAQTNPTLRYIRGLAQATEDTRVADRELLVRIAARDETATAALVRRHG
51 AMVLGVCLRVLRHQQDAEDAFQATFVALARAAASLRPRESVGGWLHSVAY
101 RTAQKMRVAVARRRKHEERAADRVHADPLDQLTVREANDVLDAELARLPD
151 KFRVPLVLCYLEGLTRDEAATRLGWPESTLKSRLEQARERLGARLSVRGL
201 TLSGVLVAAFFTGGSATAVTPALLVSTVGAATAQAGAHLPAVSAPVSALA
251 EGVKTMSAAKLKIVTTVLLGIAALGTWAGIGLSSATLEVPTQRAAVDVPK
301 PDSPAPEKARGAENELGKIERTIAKEPKYTSKTPKYCLLVFGPEAKTRVW
351 LVHDGDNLYVDRNGNGDLTEEDDRVVATNDLARFDDASEKNETRTGTTLL
401 KAPFKVGTITERDGKTKHNLWVVYAEKSEDMSERYGIWAEVNGKYIQATE
451 YAFSFGGRPKDAPIVHLNGPLAFHPWVPDYALPRGDKPGQLIVRVGTDGV
501 GKWAGAWLNPFRGIPDDIHPIADIEFPNKQVGGKAIQVQIPLTKRGSGDD
551 LFSDDLPVPDDAGEGKAKVTVHFKDWRGAQVKPLTFEVPIEPLKKP

Name Aliases LCA Taxa Group Subgroup
ECFp26279
Gemmata sp. SH-PL17 ECF57 ECF57s2

>ECFp26279 ECF57 ECF57s2 Gemmata sp. SH-PL17

1 MPTGQAERLMPTLRRVVTARQSAARTDGELLSAFIQNAGGAEYPHEGARS
51 PEAADAFAELVRRHGGMVLGVCRRVAGDYTTADDAFQATFLVLARRAASV
101 RPRERVGSWLYGVAYRTALKARMVLARRRSREKQVDVMPEPTAPSTVPAW
151 SDLQIVIDEELARLPDKFRLPVVLCDLEGRPQREVAKHLNVPAATLATRL
201 AAARRTLAARLTRRGVALSGGALAGLLGQHASASAVPYTLATGVVRAVEL
251 GAAQGTLNALVSAQAVHLSEGVIRMMMIAKLKAVAVLAAVALALATGLGV
301 GLVPAAAGDRPGATNEPNAAKAIPVTAESIDEYVAERLKNIRAEEPGLDD
351 PTFLRRLSLDVRGTVPTSVETWFFVSDGDEDKRAKVVEWITDDEAKRAAI
401 AKKLGVPIERVRVVRARVVTDDVKGVSVVEVVDVPDVTTTKVVETLNLTA
451 DGKKLMVSDDAKVVWGDKVVTNKDSRINRTVVRVADEKTVKKDDHLGVWS
501 EVVVGSKPAKDTFFQSWTATSEDKDVFLTWVSDGKQSGDKFTTTVDLFVA
551 TPDNTDAEFLKRVLTDVRGNGPTALELKYFTEDKDPKKREKLIDTLLKEP
601 AVQKKLGDEWKKKMLALKSSNQKGQVEFFYLVTPDHVIPEGKKQNLVVPL
651 ELTPTKPFVVPLPPTTPKVPKPPVPPAPSAKPFVVPDAPAAPAKPATPKT
701 PAAPKAPQSDRLEKLVGELIAAQKSDEAILEAITLATLSRLPTDAEKKLV
751 LAVAGTAGDRKTAWVAVARALAGTDVKKVDVVVPKFRVELVDPAAPSAPP
801 VPPAKP

Name Aliases LCA Taxa Group Subgroup
ECFp2625
  • RNA polymerase sigma-H factor
  • GEMOB_RS51285
Gemmata obscuriglobus UQM 2246 ECF57 ECF57s2

>ECFp2625 ECF57 ECF57s2 Gemmata obscuriglobus UQM 2246

1 MPVSVLHAVSHLIAPDDRTDAALVRAFVIDSDEGAFAELVRRHGPSVLGV
51 CRRALGPTPDAEDAFQATFLVLVRRASSTPWRAGLGPWLYGVALRVSRKV
101 RARRSRRVSRERGEVPMVEPVAPASDPDDAGAVVDEELSGLPARYREPLV
151 LCEVQGLSRRAAARELGVAEGTLSSRLARGRKLLRERLSRRGVVPVAGGL
201 GVAVPSGLAGATVRHAVAALGRSSGVVPAAVLSLTEEVTKAMMAKWKLAL
251 AVVATCATLTSLGAWNTPALSVPIARAAHAETTREQSGPAAPADAIPSVE
301 IVARVGESRVITNHDVRGVLYLMPGARGAEALAAALGAPAGTAWHNDLPA
351 QALRKAIERELILDEMHTRLKKANKLVVLDEIQEVAGPSTDRQLRALRDR
401 TGAKSDEEFVARLRTQGLTVQVIRRQMERQFMADQYVASVVKARLKGDGV
451 TRERRETERDALIDELWRKGTVRVFDPLARGALKHRITAPAQEPPTEPAK
501 E

>ECFp26224 ECF57 ECF57s2 Planctomycetaceae bacterium SCGC AG-212-F19

1 MAKGQLYHLLGFLRRLTVPLSGDAETDGQLLQRVLSERDELAFQTLMQRH
51 GPMVLATCQRVLHDADEAEDAFQATFLVLARKARAIANQASLASWLYRVA
101 YHIALNARARLAQRRAREREVADMAWPTSTGEVANPELRRVLDEELAQLP
151 EKYRAPLVLCYLEGKTHEEAARALCWPAGSMSRRLARGQQLLQRRLVRRG
201 VALSVAGLGSSIAASASSAAVPPALTQATASVAVRVAAGEAAAGLGSAEV
251 AALVDEALAAMAPSKLKIAAAILLTVGLVSAGAAALVKPGKEAPGSVMSS
301 DSADQFRANREPDWGQSVHGFRLRCSPDRPQYRWGKDLVRVDFALQNVAA
351 APNPILLMRDGEEFTDLRIVGPDGKEHLLPGREWPLPRRASWGGSLQPDA
401 VEHVSAIFDPGELDGGLEPGRYRVRGIFRRQPPAGSKLTAADFRLESNEM
451 TFTIAATGQATDTAWPAGERTGPCSLTLLPPGTRHWKPGDAPLDFTVVLN
501 RRDDDLRTLRWLGSNRLGMYYHLEITGPNGEFRHARQYAASAGVDPVSDP
551 FAAARLMFLQLDRIPIGKTLGERIAWDPSGQPVRDGWQGEPIACTGPLFA
601 PGAYQIRAVYQLRAQDQAAHAGNPLAVRLVSNTVAVCIGE

Name Aliases LCA Taxa Group Subgroup
ECFp26223
Gemmata sp. SH-PL17 ECF57 ECF57s2

>ECFp26223 ECF57 ECF57s2 Gemmata sp. SH-PL17

1 MAIGSLAGVIPRLRATALALPGATSDAELLDRFITARDAAAFEVLVRRHG
51 PMVLAVCRRILRNTHDAEDAFQATFLVLAYKAASVSPRNRLAAWLHGVAQ
101 KTALKARHRAARRTEVEKRVPARSAEDMTPELTRADAEPLLDQELAALPE
151 LYRLPIVLCDLEGQLRSAVAVTLGCSEGTLSSRLTRGRRMLAERLKRRGV
201 SLSSAAIVVILTERQVALAESLVRATVPVALAPMSASAVSPNVAQLATGV
251 LKSMFLKKLQTVTVAAVVTLGATFALTGLVADPTHAAAPVPKTPAGPALD
301 EKALNEALADVDGQLLLNRKVLKDIKCDIDQLDRIMDAVEAGTLASRKKT
351 QEAMVQIKVNANGGNVNPEAINQMFKDAQEAGEKEMRKATAEVVTKMLTI
401 PQRARLREIDLQSRGHDVFTTASVAKVLDLSPKQKEQFAANVQQTADEVQ
451 QAFQKPVQVGLGNFAAVSSFDVDSITKEARAEGMKRALAILTDEQKESWK
501 KLTGEPIKYTINRPWMGASTGVVRANAGGVMVAPRVVGVALPAPALPAVP
551 LPAPVPANPPK

Name Aliases LCA Taxa Group Subgroup
ECFp26245
Gemmata sp. SH-PL17 ECF57 ECF57s2

>ECFp26245 ECF57 ECF57s2 Gemmata sp. SH-PL17

1 MPTQLSGAVRRLGDALACRHAAGLADTELWERYVRNRDGSAFEALVRRHG
51 PMVLGVCRRILRNEPDAEDAFQITFLVLVRRAASLRAPDAIANWLHGVAT
101 RTSLEARDATARRRAKEATVPPRGAIPEGPSTELRHVLDEELGRLAERYR
151 VAVVLCDLEGKTRREVAEQLGWAEGTVASRLARGRSILARRLAHRGFAAA
201 LVAAALAGGTTSAGVPAGLVASTGRAATDEASMSAVLSGRGVPLTEGVGR
251 SMFLTKLVTAAALVFGGTVLGLVSTTGATEAPAQESTRANPDDVRERVAE
301 VKQQLQQLQQKLAKLEQEVPAGRDGAAAAGALAERFKHRVAFEIGDTETR
351 DGWRIEIREVWGTRPKIEVGGQYLVRGKYKLPAGQKGKLYFYLTASTTAG
401 AVTGTLDLQMQNLDKPEGEFTLVHGMENPGHFHLILTDPDKYSRWFANVY
451 FGTGDTVWRKKP

Name Aliases LCA Taxa Group Subgroup
ECFp26205
Gemmata sp. SH-PL17 ECF57 ECF57s2

>ECFp26205 ECF57 ECF57s2 Gemmata sp. SH-PL17

1 MNRLRTGPLPVVQLRDALRSDLDALPDAELLDRFVRYADHPAFEVLLRRH
51 GPMVFGVCRRTLINVSDAEDAFQATFLVFIRKARSLRRADRLGPWLYGVA
101 CRVAMKARARAARLAEYRTEVHEMFSDPNVPAAVPDWLPVLDTELAALPA
151 KYRDALVMCELEGASRADTAKALGVPEGTLSSRLARGRELLRRRLLKHGT
201 LLPTGGLAALLTTNGVGRAVVPAALLARTSELAVAATSAATGAVPVGAAQ
251 LTDEVLKGMLLTKLRGAGVVVLALTLVATGFATAWSGEEPRAAAEDKSIG
301 AAPPARAAEALPQPDAKKLSVGGPKLSDRDAVQGLWVNEKLNVIGKQLTE
351 GELKEANEMTGRMQILVSGDKWWTMGTGPNGVLGTAVAQLAVIDETKNPK
401 WLDLRVWPVTSHGSHWRCIYELDGDVLRICMCAGDHTSTRPAEFEADPGT
451 SLMVMTFRRGKLPPAVGEKSLVGSWVGEPPAGDSSTVRPRVEILDSYLFV
501 TNPKTGHWVGGRYRYDATKNPKWVDVELTTAIEDGKVTKLYGSYEVTDRG
551 LKLALGATGKRALRPLELDAGSDVMYFNVKAAKGPPAAQTGTPEKVITAP
601 VPHAKSRVLEEDEHIQALMNTCNFSGAEIFIRKHLADYKGLELAARSLQL
651 GICLTQRAAQSDASVAITLRTEAADRFREAITEVETYQKDSGTDKRAVFV
701 RTQAELRFLGVYQQAGKSDEVITAAGPMLERYKGTVEELVILRVTYHAHS
751 KKGDATQAQKTRDRMKTAFEKLKDKPGAFPESVGEHSRAYWEKIWFANDL
801 AVTGSLP

Name Aliases LCA Taxa Group Subgroup
ECFp26191
  • RNA polymerase sigma factor, sigma-70 family
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Singulisphaera acidiphila DSM 18658 ECF57 ECF57s2

>ECFp26191 ECF57 ECF57s2 Singulisphaera acidiphila DSM 18658

1 MKTMSQDLRTLFGGAGALGRWTDGQLLDVFLARREEAAFEELVNRHGPMV
51 WGVCRRILHRHHDAEDAFQATFLVLARKGDAIVPRERLANWLYGVAVQTA
101 LKARTLILKRGERERQVMTMPEPAARRLSLAEDLDLGPWLDQELSRLPEK
151 YRAPIVLCDLEGESYQAAAGRLGWPIGTLSGRLSRARALLARRLNRHGQV
201 LTAATLTLALAEEGTAASPPLALVDSTARAATHFAGGRAATELISAQVIA
251 LAESVLTALVLSKVKVVVACVLMAGLVGLSLGGQVVTADVLDEQAAPERT
301 EAHGGEPAKRIAKTVATPEADLEFLQGTWFGSVTEFGGQPLPIKPAGIPP
351 QVQLIFKGDRLRFRGPALDKTISFGTIEEREFTLKLGGEANRLTIDLTLS
401 PVANDEPPLTYRGIYSLWHGHLVIGLNAPGQKRPKDFKTEVQRPRWLLDL
451 NLAVLSDYESNSVRINSPIKDLKVRNRNESLKSLEDRKKQAISRNRELFG
501 DR

>ECFp26172 ECF57 ECF57s2 Planctomycetaceae bacterium SCGC AG-212-F19

1 MAQGKLGSVLWHIRQMLGKSAKSALTDRQLLERFAAQRDEQAFATLVQRH
51 GPLVLTVCRRLLPNDHDAEDAFQATFFVLARKATALHWHESVSSWLFEVA
101 SRVASKANGRLIRRQILEKQAQVMATVDPASAATRRELQLVLDEEVRRLP
151 ERYRLPVVLCWLEGLTRSEAAEQLGWKEGTVGGRLARGRDLLRRRLARRG
201 LALSAGVLEMILAENAATAAVPAPLTDGTVQAAVQFVAGQLAAGTSAEAA
251 TLASETVSALGVARLKRVAAVVLAVGLLGVGTAMVAHQALVHPARVGSEA
301 GKRADDKAIRPTVALDPGQDPQPGGAPGSPVLPGALPGAAVTKSGDKATA
351 GSDRK

Name Aliases LCA Taxa Group Subgroup
ECFp2616
  • RNA polymerase sigma-H factor
  • GEMOB_RS52650
Gemmata obscuriglobus UQM 2246 ECF57 ECF57s2

>ECFp2616 ECF57 ECF57s2 Gemmata obscuriglobus UQM 2246

1 MAVSQPLCNSLQQLNRALLAAKLADLPDAELIGRFAERRDESAFAALVRR
51 HGPLVLGVCRRVLRHEQDAEDAFQATFLVLARDATAVRRAGAVGSWLYGV
101 AYNVARRAETARRRRAAREREAAVRQPTAAPETAPDDLRDVLDRELNALP
151 DKYRTAVVLCDLTGLTAQQASVEVGCPAKTLGTRLARGRALLADRLVRRG
201 VGLSVGALVAISAPSAAGAVPPRLAEFTVQLVAGSNTGPATAPPAVAALA
251 EGVSNVMALKTLKLVAVLVCGVVLVGGVAKHGGFALHARHTKLARSAAPG
301 TTETPDGSPAVEQKNPADFLDHFHRFIEHVHDVLGIGPGEQIAAAPGEGK
351 KDETPAGVWVKKDGELKVEFSEKGVLSLSPHGENKVVVIVCEFGPGKDGL
401 VKAKVTGFEGIEEAKKKIMDRLPLGTEFTFVWKVNGGSATLGDVKSGKDT
451 ADVLKSHLEAEYTKK

Name Aliases LCA Taxa Group Subgroup
ECFp26169
Gemmata sp. SH-PL17 ECF57 ECF57s2

>ECFp26169 ECF57 ECF57s2 Gemmata sp. SH-PL17

1 MNRLRTGPLPVVQLRDALRSDLDALPDAELLDRFARYADHPAFEVLLRRH
51 GPMVLGVCRRTLANVSDAEDAFQATFLVFIRKARSLRRADRLGPWLYGVA
101 CRVAMKARARAARLAEYRTEVREMISDPNVPAAVPDWLPVLDTELAALPA
151 KYRDALVMCELEGASRADAAKALGVPEGTLSNRLARGRELLRRRLLKHGT
201 LLPTGGLVALLTTNGVGRAMVPAALLARTSELAVTATSAVTGAVPVGAAQ
251 LTDEVLKSMFLTKLRGAGVAVLVPTLMATGLAVAWSGEEPRAVEANGVAR
301 APAPSGSKPLEHGLVPSAREQIPSANTGPGAALSDQDAMQGLWVAERVEL
351 GRGGRSFPRGLRRGAAPNPAGCNTPIPT

Name Aliases LCA Taxa Group Subgroup
ECFp26161
Gemmata sp. SH-PL17 ECF57 ECF57s2

>ECFp26161 ECF57 ECF57s2 Gemmata sp. SH-PL17

1 MSHGPRRLPRIPALSPTGPPVDADLLARFISTGDEVAFELLVRRHAPMVL
51 AVCRRVLTDPNDADDAFQATFLVLARKAASVARAEVLAGWLYRIAYRAAV
101 RVRSDRLRRATHTDANPDLLPAPSADPNARELERVLDEEVAKLPERHRVA
151 FVLCCLEGKTGEEAGRLIGCPPGTVSSRLTRARERLRERLTHRGFAPALV
201 VTVLSACAESAATVSALTALIDSTVHAAPGFATRRPTAPLTARPATIAEG
251 VIRTMHATKLKSLALLFALGLLAVGGVFAAPNAGPEEEPNQPPKAKVGGA
301 QKAPAAPVVRVVQPQRGGLDRISRHIGSVEPLQQADLFATTAGTLKRVNV
351 NLGDHVKRGQLLSEIDAPALTLEERQALISVEQAKGLLSEAEAGLPAARA
401 VINTAKLVVKQRETEEAGAKAALVIWKKKYEMTVKISGPITSDASDAELR
451 LRTAEAQFEGATVAVESAKSDITVKQSKLLQAEANVGAAKTTIEAAHLAL
501 EKARFALAQTKIVAPFDGVVTRQNASAGDHVRPTERDADRALFTLTRVDR
551 VRLVTAIPESEVARATVGVVAVVTFPSRPGVRISEKISRIGFAVDPKTAT
601 MRVEVDVPAATNDIRPGMIGEVTLTLGKGPADALRVPLSAITEGPKERPA
651 GSHGVYVYRDGKARLTFVKVSQHSENEVEIASGLTADDLVVVDPKGLGSK
701 PEVAVKLE

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more