ECF proteins of ECF subgroup ECF57s1

Displaying ECF 1 - 20 of 121 in total

>ECFp161960 ECF57 ECF57s1 Paludisphaera borealis

1 MANARSSHLLHQVGRLFGAGVSGGLTDAQLLERFAARCVASVDARSNAEA
51 AFEVLVARHGPMVLGVCRRALTDPNELEDAFQATFLVLVRRANSVRVDDS
101 LGRWLHGVAFRIAAKARSRSQRIRVCNIDLAVEPTASAFAADQSDLFAAL
151 DKEVRRLPEKYRAPVVLCHLEGLSHAEAADRLRWPVGTVSGRLSRARALL
201 KDRLVRSGHSPTAGAMGILLTPAAARIAVPECLAAATVRAAIGLTTTGKG
251 GAGVASTAAVSLMNEVLRAAVAFKLKVGAAVLLAIASTAVVIPGVVAGAG
301 SRGGEEDPASPPAAVSRVEAVKPAHHRPADEIVKELEARLATARRPLMHD
351 VFLQVHGVIAGLVLELRTAYPDDIRGYRHMLDRWLSLSYAQRKPEAIDEV
401 RFVLGTTKDPELKKDALYYQSIIRLQEHIDGPAAASLARYYAREMEGDKR
451 AAGSLYQAATRLQTTGYIRLGLAAALVVVCGLLLIKRRGWKSLLRFLFRL
501 GLAALAILAVAACGVRLASDDGLSRIILETIQKTNGITNDNELRNRAMMI
551 GSWLAYFLLPDIQSVVLSRRAALAAALALASAWVLIAVRRRRAETTEPVA
601 STLRTGVLGFVGCLALLCAADAAFLFIQRSSLLNQAVRDYPDSFYGRMVQ
651 GENRRRDRIGEPFELEFNDAISGRRVAMKDLRGKVVVVDFWATWCGPCVG
701 EIPEMLRLYNEYHDRGVEFIGVSHDAPVEDGGLDALKTFVAERKIPWPQY
751 YQGHDNHRIVAGEPTDDFSESWGISGIPTVFVVDAEGKLHSTEARGRLET
801 LLPRLLKER

Name Aliases LCA Taxa Group Subgroup
ECFp26184
  • RNA polymerase sigma factor, sigma-70 family
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Singulisphaera acidiphila DSM 18658 ECF57 ECF57s1

>ECFp26184 ECF57 ECF57s1 Singulisphaera acidiphila DSM 18658

1 MANGHKGAVLRQIQRIFSLGTVSGMSETQLLERFVAFKDKAAFEAIIARH
51 GPMVWGVCRRVLTDPHTAEDAFQATFLVLLKKAGSLRDPGRLSPWLYGVA
101 LRVATRARSEDARRSTREQDVAKEEAVEPVVLDDLGCVRAVIDEELNRLP
151 ERYRWPMVLCHLEGKSYEEAAHQLCRTEGMVRGRLARGRERLRTGLTRRV
201 LAPSAALITAALSGESATAAVPASLVTATIAVARIVTLGGAMTTTATLGP
251 ILKLAEGVLTTMLFSKLKLTGTLTAIGTVIVTTLPIAFAYDEKPKSHVDK
301 PTQNTKLQAPSDRTVELVPKTNTVTQPIDVRVLHQQTGEPLTDVTLEVWI
351 NDQSKIEGKTDRAGHYSFELPQANPNSLWIKAKTDGFVPASMAWGLRQPG
401 VFPVPKALKFMLEPGTSIGGTVQDSEGRPIEGATVFLLVPSKADKTQQQT
451 SVWDYPVKTDDQGRWQCNLLPSELDDIWIRIQHPDYISDTRYGSTPKPTM
501 VQLRDQTGVMVLKKGLPVTGQVFGYDGQPIAGANVAQGANRPGGHEPEVK
551 TDAKGRFKFDQVAPGDLVLTVQAAGRAPDLKTVKVIPKMSPLEFRLEPGH
601 VVRGRVVDPEGKPIAGVWIVAEEWRGHRSLSLETKSQADGSFQVFDAPAD
651 TILFQFVKAPAFRNLMNQPLAASEVGHVVKMIRPVTIRGSVVDSESGKPI
701 EAFTLISGDDPKGKSTRWERNRPLRFRDGHYEVSLDWPYPVQGLLVEADG
751 YLPAISHGFSIMGSNQVYDFKLTRGKVPTRAALAGVVRLPDGSPAADAEV
801 GLATNSHGIYVRNGSFSPPPNQFPTVRTGIDGRFAFPPQTEAATILVLDD
851 RGFAQVTEEQLLATDSLTLTPWGQVEGTLRIGNKAGAFEEVSLSPKAQSQ
901 SDDQRISYHYNVATDDSGHFLLTRVIPGAASISRTIKLSANSYGVGPWYP
951 ILIEANQTVQATIGGQGRPVAGRVISLAGTKTPFASMANRNTLLLQAPLI
1001 PMPEGLTREQRIEWYNAWIVTEEAEAYRAYQKQRSILHYPVKVEPDGTFR
1051 IEDVEPGTYELLLRFDLSHLRLTVMVPKIPSGRSDIPIELGEVKLIPWES
1101 GE

Name Aliases LCA Taxa Group Subgroup
ECFp26151
  • RNA polymerase sigma factor, sigma-70 family
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Singulisphaera acidiphila DSM 18658 ECF57 ECF57s1

>ECFp26151 ECF57 ECF57s1 Singulisphaera acidiphila DSM 18658

1 MASGHRGAVLRQIERVFSLGTLSGMTEEQLLEHFAARHDEAAFEALIARH
51 GPMVWGLCRRLLHDPHDAEDAFQATFLVLLRKAGTLREPGQLSPWLYGVA
101 FRVASRVRSDPARRREKEGRVARPEAVDSDVFRDVDGLRDVIDEEVNRLP
151 EKYRRPVVLCHLEGLTYEEAARQLQWTTGMVKGRLTQAREQLRRRLTTRG
201 LAPSVGLAGPWGFPTTVPQALATRTAEVAAHIATAASASILALAEGAIRT
251 MLFTKLKAAASVLAVGTLMLAACAFALAQTGEKNQAVATPLPEKTVVPKP
301 SPVVGRSMEFRAVEPGTDRGIPGVQLTVRAGDLQTKAMTDETGRYLIEGI
351 PPKVVSSVAIWARKDGLVPKSITWWNDSANTRLPESYSLPMEPAATIGGL
401 IRDETGEPIEGATVYIRADSKRGDGVPVTDVFEFPAKTDAQGRWRCNLVP
451 ADTSSVSTRLVHPEYVSDQSYGDTPVPSPEQLRARSAVMVMTRGATLSGT
501 VTDAEGRPIPNAHVKLGLDRFSAPQPPSTRTDAEGHYQFHVKPGSQVLTV
551 QAKGHAPDLKRLPAVQGRERVDFQLPPAQPFFGRIVDRQGRPVAGARVVV
601 DTWRGYRTLEVKVTSDAKGRYRWEDAPADEVLVDIAMGDYMPIRRKPMTA
651 SPQGDEITLSPMLHVHGSVVDAGTGQPVEAFKVVPGIVIDGAKPPHWLYG
701 DLRSATGGRYEISLDDPRTPHVRIEAEGYQPAVSRPFQVDEGDTVYDFKL
751 QKGTTIAGIVRLPDGTPLTGAEVILVTPGLSPTINNGRITQRDRNPWVET
801 GPDGRFSFPAQSEDYSIAVFHDRGFGELSSQDLAADPVVTVRPWGRIQGT
851 YRIGSMPGGRQAIQANRQRPAIGRDLKPTFGPGTELYYLFHDLADDQGQF
901 ALDRVPPGLYLVAPVFHEPRGLTTASGQSATVEVRSGETRSVALGGKGQP
951 VVGRIVIPKGFDRQVDWSYGSFQFETALECPTPPKGLNAKEQSRWWWESE
1001 ESKAYSRAFHRFPLRIGPDGSFHVDDVPSAPYRLSIQVYEPPSGNDRSAA
1051 AKIVGMATRKFVVPELQGGRSDEPLDLGEIPLNLNKRVGDLAPAFQVPAL
1101 NGKTVALADYRGKYVLLDFWATWCAPCLAETPHLKATFEAFGKDERFAMI
1151 GLSLDASKDEPREYVAKQGLPWGQGFLGAWSEATLPAEYGVEGIPSIWLI
1201 GPDGKVIAMNLRGDQIKDAVSKALAIP

Name Aliases LCA Taxa Group Subgroup
ECFp101447
  • hypothetical protein
  • RNA polymerase sigma factor, sigma-70 family
  • ... more
Singulisphaera acidiphila DSM 18658 ECF57 ECF57s1

>ECFp101447 ECF57 ECF57s1 Singulisphaera acidiphila DSM 18658

1 MTRLQPAVAFRQMRALFGLGAAGGLTDEHLLEIFSTGQREAAEAAFATLA
51 ERHGPMVLRVCQGVLGDSHDVHDAFQATFLVLVRKAGSLWIRDSLGPWLH
101 GVALRVATKAKVAAIRRQTHERRAAEAGEATCHGEYDGHASTLHEEIDKL
151 PQKYRAPIVLCYLEGLTHEGAATALNWPVGTVRGRLARARDLLRTRLIRR
201 GLVPSAATLGAILTAEGASAAPLSEPSIRTLLSLVAERSAGLAPAAVAAL
251 ADGCLRMMTMARLKIATVLLLVAFAALGLAEAARTKSPGGDHRAVQAPLL
301 ARANADADGPAKPTPPESWPAGVEVKGRVVDHDGAAVAGADILLLGSEQL
351 TVYANAGAKEGQVRSSIATQPANAAPSVKTDGQGRFSLRRSGSPANRIAV
401 VSAQMLLWEVTRKEFADANNLLITLPKPVALTLHAEIPEKPAKQEFWMTG
451 RLLNRVDWESDSVFYREIQVPNPGQRIVGSLPPAQYAIERINFTPQGRGS
501 NLMTQCERRLLPIEPGKRVDVTFDRKIGRRIEGRVRGLENVKLRYAMVSI
551 GFFGPEEQFSPGGKKSSLVTHFDVLSIGPDGRFATPLLPPNRYEFELSAM
601 RATTPNQDGQSYDGERLDSWWNLCTQEGNRRYLRKTRPRKRSPSMPTAPV
651 PPEKQAEIAGLEQAIREAGDAEISELAANLAITDDAHLFGANEFKIRALA
701 HKIAAKAIEQHLTRKKTDTTEPA

>ECFp166853 ECF57 ECF57s1 Paludisphaera borealis

1 MGDLLHTGSFTALSDGQLLERFATRAREAGEPAFAALVARHGPLVWRTCQ
51 AVLRDDHDARDAFQATFLVLVRRAGSLWVSESIGPWLHRVAFRTAVHAKR
101 DKNRRRAVERQAAERTPAWTVPSISDDLSLAIHQEVERLPDRHRIPLVLC
151 DLEGRSYEEAARHLGCPVGTVKSRLARGRAHLQDRLIRRGITPSSAQQTL
201 IMIGAPTSVSLPPALLESTVRAAAAFAVGPLQAACGLSALSITLAEGVLK
251 VMLFSRLKMDAAVLATIIGLSTLGWLAHAAPDDSPRPAPAPRNVEKNTSA
301 PTVDLQGNWIVRGYPSGQAMSLIKIEGRRASARATLLAILMPEHYHFAES
351 TIENFQIDDKAVRFTLKIAATRPIDARVLNVVAYLPKDQAEPKVLRGSID
401 FSQQGQFPAILDRTDLKELDPKEALAAGNDELRRFNQTKDREKQVEILKE
451 MLKKYAEEPMAPVAGWALAITLADDKAPTAEVRAAVDRAIEVAARYGPEM
501 EVGTINLIVRNLVGAEDLEDLTLEYARKAEAMLRASYPVALQENALQNLV
551 NVLPKSRKIDEAAALAEIKTVEARLAKLGIPAAAETQRKPGAVHWARNFA
601 AARKEAAKAGKLVMVDFSTQTCGWCKRLDADVFPKPAVVEAMRRFVPVKV
651 DAEDGEGRPLVERYQAHIQGYPAILFLDPAIEDAHDGRIVGKIPGYTPPL
701 AFVELLNVIAGLPRDLPKLREQLKAHADDDETARRLATSLAMQGELMEAG
751 ELAGRPHGKETDPTVDSWASVYNTIGDELLIRQKPAEAAEWYDKAGRTAK
801 RPIDVYLARVGVGMTTAYQGKPEEAVKELEAAAGVVGVSGDEREFAQTLL
851 KSLKADVKTRPSTPK

Name Aliases LCA Taxa Group Subgroup
ECFp26319
  • RNA polymerase sigma factor, sigma-70 family
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Singulisphaera acidiphila DSM 18658 ECF57 ECF57s1

>ECFp26319 ECF57 ECF57s1 Singulisphaera acidiphila DSM 18658

1 MRPVQRGEVQRQLHALFRSGTLLAGLSDGQLLERFTTRGDEEDAERAFAT
51 LVERHGPMVLRVCRRILCDAHDAEDAFQATFLVLARKAGSIQRRNSVGSW
101 LHGVALRVAAEARSATARRQAHERKAAELQQRAEPVTPAESDDLGGVVDE
151 EIGRLPERLREAIVLCYLEGRTCEEAAAQLGWPVGTVKTRLAKARAQLGP
201 QLIRRGVAPLAAMALASSEAAAFVVVPTTLGESTIRAASWFAGTQATIQA
251 GTVSASVITLAERGIRNMRIAKLKLVAGLLSTAGALTIGTGLFLHQTWGA
301 QFGSGAPIPPAVPVAPATPVPPVPPTPPAAPLTPLPPYSPAQDLDQPLAQ
351 QVPPLSPRPRWEYRTQVGENIGEFNRLGNEGWELCGVLERTTPQSPTFIF
401 KRQSGVAKPPVVQTTEPIPKPAAF

Name Aliases LCA Taxa Group Subgroup
ECFp26316
  • RNA polymerase sigma factor, sigma-70 family
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Singulisphaera acidiphila DSM 18658 ECF57 ECF57s1

>ECFp26316 ECF57 ECF57s1 Singulisphaera acidiphila DSM 18658

1 MASRRLGVTIRRIERLFHLGTVAGMSEVQLLERFVLQRDEAAFEALVARH
51 GPMVMGVCRQWLRDPSDAEDAFQATFLVLVRKAGSLRDCALLGNWLYGVA
101 YRVSLRARAESAKRRSRETARIDDRVDPQEPGSQERYPWLYEEVNRLPEK
151 YRAPIVLCYLEGRTHEEAAEQLCWPVGTVKGRLARARALLRSRLSRRGLA
201 PSVGVLTAALSGDALAAVPVSLIESTVLAASGLVAAKGVAAGLIPAQVAL
251 LMEGVSHSMFLSKLKLVAASVVIAGLVTTSAGVIARQAPGARSEHEEGER
301 SAVGSNGPLKSAGPRETVTLPNRLLGEAISGQGSPKTDQEHIGLDGKPID
351 RNEEEIPLDPQRDDPRIRAALARQALDWIAARQTNGQEVTPESEYERLLR
401 LSEWSLRLFEAERQASATKSDRVAAAEAHLARMKKALDLSVQLQQSGMLT
451 NLDSFETAFRYREAVKGVIDAKTDQTPVVGGTISGNETLPGSTGHMQTPV
501 RPGPGPLVSTDSQANYNQTSLPGPTTRASGPGVIRFIPISTPWSLPGETT
551 RATTIGEAQQQGGGGFHVATIDGGGVGRYDDADHERRATIAQKARRVAVN
601 DTSPQTKGILKKLDDPISMSFGKETSLSDILKYIKSATTGANDTGIPIYV
651 DLVGLQEAKKTMSSPVTLDLEGVPLKTTLRLILKQVGLAYCVKDGLLLIS
701 SPRGIVQELEEAESILDDESPQPR

Name Aliases LCA Taxa Group Subgroup
ECFp26299
  • RNA polymerase sigma factor, sigma-70 family
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Singulisphaera acidiphila DSM 18658 ECF57 ECF57s1

>ECFp26299 ECF57 ECF57s1 Singulisphaera acidiphila DSM 18658

1 MKKTSGKSALGRDFPPPLELGTAAELSDGHLLDRFVAQREEPVFEAIVLR
51 HGPMVWGVCRRVLRDHHDAEDALQATFLILARKAASIQPREKLGNWLYGV
101 AYLTAKKAMASRARRRALDGKAREAKAWENKVLDPPHPGADPGDPLDELL
151 PKLDRELSRLPGKYRAPVVLCELEGKTHKEAAEQLGWPIGTVSGRLSRAR
201 GILAKKLSCPGAALPAGSLAALLARDVSAANVPAELVGSTAHAACLVSAG
251 HATAASVISAEVATLSAEVLKTMFLSKIAMSSLLVGLVGLGGTGIYYGVQ
301 SASGDTAPKTQTAQAAPAVVAGPGTNWPVDDVPEETRKAEPAKDQRPSTP
351 AVPAANPAADDTAKLQGTWNAVQIESNGKTLGKDAVGVRDMQFIIEGDQL
401 TIPGVEAGSQGRAGSGGPARRKRFALDPAKTPKAIDLTSLDGREKGETAA
451 CIYKIEDGRLTIALAPAEHPEARPEDFKTAAGDGILVITLEHANIKKN

>ECFp26280 ECF57 ECF57s1 Planctomyces sp. SH-PL62

1 MSTDPGVATRIQTLFESGTLSGLSGRELLDRFATHGDQAAFEAIVARYGP
51 MVLGVCRRLLRDPSDVDDAFQATFLVLVRRARSLGTDDVVAAWLHGVASR
101 VARRARADRSRREARMRTGLDSDSHSHSHSVAPSSPDFALKAVIDEEIER
151 LPWKYRAPVALCYLEGLTHESAASRLGWPLGTVKGRLARARSLLGSRLTR
201 RGVSTSSVAIAGSLALDRLGRAAVPNPLRLAVVRAALRIVGGSPWRSVVS
251 LPVVHLAQGVLTSMIFTKLKSAGALVLAFGLLAAGAQVAARQPGDEPRPD
301 VEQTRPPATRPEPEVAPMLQGFVGRVPVSTPSPEDRFLDAARRAFLEAAE
351 DHAGGRASLDRVYRASRLLLDAQKDRAETEEGRKAAFAEHLDRMRVVAQA
401 DLSRASGDAGSSHFAETRAMLAEAELWIARGQDERRPPQPRDGGTSDAKG
451 DPSDAEGERNPKSAAILKKLDQPLAMNFPNETPLEDVLKYVRQATQGEHD
501 AGIPIYVDPLGLNEADKTTTSPISIDLDGVPLRRTLQLLLKQLTLVYFVE
551 DGMVVITSTESGRNGLGPEMASPSPLEQELDRASRGEMTLDELKAFSEKL
601 KAIQEVRTLNEKLNSSPPFTGGGIGPHSPSTPSQ

Name Aliases LCA Taxa Group Subgroup
ECFp26269
  • RNA polymerase sigma factor, sigma-70 family
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Singulisphaera acidiphila DSM 18658 ECF57 ECF57s1

>ECFp26269 ECF57 ECF57s1 Singulisphaera acidiphila DSM 18658

1 MAKSESPAVLRDVQTLFSLGTLHGLTDAQLLDRFRSGTDHGSETAFAGLV
51 ARHGSMVLGVCRRALNDPHDVADAFQATFLILVRKAETVEARDSLGRWLY
101 GVSRRVAVRAKRTAARRTAREVNGVESLAVLAPPKQDNDLPVILDEEIGR
151 LPEKYRDAVILCDLQGLSQEEAARQLGCVVGTVKSRLSRGRERLHSRLIR
201 RGVAPAIAAWCGDSVATEVPAAMAEATVKAAIRFAAGQAGAAGAVSACVI
251 ELTQGVLRAMLFTKMRVLIATLATIAALATGAGVLARQTTAPEPQGEQTA
301 GREEPQTKDSGNKSKTVIEAGAIIDDPAGNDEEPADRADTLQIDIELLID
351 ELDSLKKAYSQHVTLDFQLLGGGLGGGRMGPSPERDEQLKATRRLQRENT
401 LNLRETYLEKSKELKRKQRELHKLLGQKQSSVRAQPIRPSGSSTSRSSAA
451 AQAKASPAIEQRVSDIEHKLDEVLKLLNELKR

Name Aliases LCA Taxa Group Subgroup
ECFp26264
  • RNA polymerase sigma factor, sigma-70 family
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Singulisphaera acidiphila DSM 18658 ECF57 ECF57s1

>ECFp26264 ECF57 ECF57s1 Singulisphaera acidiphila DSM 18658

1 MEDKWSNASLREFQSLFGGGVVSGLTDRQLLERFAERRDEVAFAGLIDRH
51 GSMVLGVCRRVLSDPADAGDAFQATFLVLVRRAASVRVDDSLGPWLYGVS
101 IRVAKRARTVANRRRRRERTNMELPEPATRGADPDVEMRLRIDEELQRLP
151 ARYRSAILLCYFEGLTHEEIARRLSCPVGTVRSRLARGRDLLRSRLERRG
201 LAPGAPILTSVLVPASGWPELLSTTTVQAATRLVAGRSLAGVVPVSVEIL
251 VDGVMRTMVMTKVAILTSLLAGTLIGIATYASQEVDSRPPASHRQVTPIP
301 RKEPIPKPAVAGTTVLALNLESSKDDAQEDAFEGFPAVVVKTVPSTGTTD
351 VDPRLKEIQVTFSKEMMNKSWSWAQHSKKTFPELAGEPSYTKDERTCVLP
401 VKLVPNKTYAIWLNSPKFGNFKDAEGRSAVPYLLVFRTKGS

Name Aliases LCA Taxa Group Subgroup
ECFp26235
  • sigma-70 family RNA polymerase sigma factor
  • RNA polymerase sigma factor, sigma-70 family
  • ... more
Singulisphaera acidiphila DSM 18658 ECF57 ECF57s1

>ECFp26235 ECF57 ECF57s1 Singulisphaera acidiphila DSM 18658

1 MADARRTEVHRYLRGLFNVGTVAGLSDGELLDRFTARRGESAELAFAALV
51 ERHGPMVLRVCRKVLHDSDDAADAFQATFLVLARKAGSIHRRSSLGAYLH
101 GVALRVANCNRLAVVRRRRHERTYAEKAGTAYQAKPPDDLGRVLHEELGR
151 LPERFRGVAVLCDLEGKTYVEAAGLLGCPPGTVMSRLAEARRRLRGRLAR
201 RGLAPSAGALGAVLAAESAATAKGLPAALAEATIQAATRFAAGPATVGAV
251 VSASVTTLTEGVLRAMFLTKLKSVAMLGLVGGVVATGAGVLAQVPEPLSQ
301 ASPRLASEPAPQYPGPVTPADERLHSLENKLDRLLKVLEANAVKTSSPAA
351 LNSSVSSMRPGMGMASGMGMKRALGPPMDSGMGMTGSVSGGMNPLQLTNA
401 VPERRNQAANLNLAQVDPNRVPNVEERLGMVEQRLDELVGRIERLEGSGL
451 VNSSGEQSAQMMGGGVHTSSRRTAHTSESEASPDVSRSASPALPSPSIHS
501 VAPIPTAPSRSSSDVLPDQSPQE

Name Aliases LCA Taxa Group Subgroup
ECFp26216
  • RNA polymerase sigma factor, sigma-70 family
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Singulisphaera acidiphila DSM 18658 ECF57 ECF57s1

>ECFp26216 ECF57 ECF57s1 Singulisphaera acidiphila DSM 18658

1 MGRISDGVSRLHLRLLFSVGATAGLTDGQLLERFATHGGEAAELAFAAIV
51 ERHGPMVFRACRGILRDDHEAMDAFQATFLILLRKGGTLWVRDSLGPWLH
101 RVACRAAGRAKVNASRRRVHEHGAAERGNRPEQSAIPGDLAEALHEEVDR
151 LPNHYRVPVVLCDMEGRTYEEAARYLGCPVGTVRSRLARGRERLRGRLIR
201 RGLAPSAGALGLALSARAATPAMPAHLLGSTIQLAKRILVGSTTTAGEVS
251 ASVLELAAGVRRIMLMSKLKCVLVGLLAAVGLAAIGAGVLAQQTPQAGDQ
301 AVSKPLRVAEGDRPWIRTLPNGATIEVIGVSTHPSGPQTWWGPEGSPLAQ
351 PLCDPSATDLAKAGTSIFGGKSIYRAVVVRVSNLPPDSKHGLWMRQSRGW
401 YEPATRDGKIVPGLSVVISEHPKDLAASALHFEVATGPWQVVEAWDGRNP
451 GTRPAHGSVPNSLWGRAIATKKGTTLTVTHDIEGTAVRLVAVDRKGEEHP
501 SPERGGSRLKGFTQLEGEFDLSPEEIQEYRLQQRHFEQIDIPNIALEPTT
551 TE

Name Aliases LCA Taxa Group Subgroup
ECFp26207
  • RNA polymerase sigma factor, sigma-70 family
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Singulisphaera acidiphila DSM 18658 ECF57 ECF57s1

>ECFp26207 ECF57 ECF57s1 Singulisphaera acidiphila DSM 18658

1 MASAHQGAVLHQLGRLFGRGTVAGLSEWQLLSRYLNDRDEVAFEAIVARH
51 GPMVLGVCRRLLVDPNDVDDAFQATFLVLVRRANSLGERDAIGHWLYGVA
101 HRVALRARSEAMRRRWREPSVATTPVAPETDATIFELGPLLDEELGRLPT
151 KYRAPIVLCHLEGFTHEEAANQLQWPLGTVKGRLARARELLKARLIRRGL
201 SLTLALSATTLARKSLAAVPETLSSTTVATAMKVAAGPITAGMVSASVAA
251 LLEGVLTTMFWTKLRTATAALLILGFLAGSVGVVAQQSNEKRPTEPVIVE
301 TLKNRDQDDQAASAPASHEAKSVERKILDPERPSQAKSQSQLANQIFQEE
351 LRGKADPTGTKLTSLIHWSKAILNDSNQTAAHRAEALSDHLGRMRTLREI
401 VIRLEPSEAKNSLLLQAEYYQQEANQMLARAKIDSEGPLTGRRPGPKRSD
451 EDPRSKALLEKLEEPIDMVFSNETPLEDVLKYINSALAGPKGKGIPIYVD
501 PVGLQTAEKTMTSAITIDLQGVPLKTTLTLLLRQLGLAYKVKEGVLFISN
551 EDDEDNPLTNLENKAERGELTPDEASELVDMLKTLNEVKKLKAEGWRLDQ
601 ERLKPAPDKGGGFQ

>ECFp26197 ECF57 ECF57s1 Planctomyces sp. SH-PL62

1 MGRNSLEVRLIDRVLRWGTATGEADDLLLERFLAERDEGAFAALVDRHGP
51 LVLGVCRRILRDGRDVEDAFQATFLILARRAGTIRSRERIGPWLHGVAHR
101 VAVRARAISARRLVREGIGLDVDPATDVPPGCDAERLELRSILDEELGRL
151 PGRLRDPLVLCHLQGLTHDQAAAALRQPVGTIRSRLSRGRERLRDRLARR
201 GVSVDDARMGLVVIAHQLPTALFESTLRSAVAFASTPTIPLASASAAVLA
251 NGALNAMLISKAKLAAVALGMMLTLGGVSGHALQQGVEERPDPVAPEVVA
301 APATLDGPETTVERLEGMQKELDEALAQREALATRIDNLRTSVVRLRSRL
351 QTSGGVVVYDEPIKSQVPQPEASTLPLADSLRNYLEQLEKKLHVAGIKRQ
401 SAEAEYDMMIKDREVVREKLRDLMRPSEKNPAAPTPAPGEAGAPTRHGET
451 SDSDPAHPAATVAPFLDRRPLSSSAAGSGKRSYLASPKMILVSSKDGHVV
501 TGYSSETGGEARSIRLAPEGGAKIKVTPYLGVSVAALALEGEAVDRIAVF
551 SATDGEWHPYDLVEPTRSAMPQIGAAAVGYKIGRRIYAFSFVANKWDVLE
601 LPEDGPDLLWANPETITYQSRGRLHVFSGKTGKWASIDVSNATEYSASGF
651 P

>ECFp26176 ECF57 ECF57s1 Planctomycetaceae bacterium SCGC AG-212-F19

1 MSSSQLSKVLRRLRHIMGDEGAPDETDGQLLQRFISHHDESAFRVLLDRY
51 GPMVMGVCRRALTDPHDADDAFQATFLVLVRKAASIQGQELVGNWLYGVA
101 FRVARRARSTLARRGLQRAEVPDMAIPGLQSETDSQEVRLLLDEELQRLP
151 RKYRVPMVLCYLEGQTNEATARYLRCPAGTLKTRLAKGRELLRARLERRG
201 LALSAGALGALLAPEAVRAGVAPALADATLHAAALYTAGTGAGVSAPVAS
251 LMEGALREMFVAKLETIAGVLLLLSVIGAGAGFLTYQALTSAKPVVAADD
301 PSVGDLPAFQGEDGGLAISVDQRIREWEPLPQERRFDEIGWANSLAEARR
351 LAAQHGRPIFLLTVTESIATGRCRASAFNVRAGALSNDAVIGLLNRSFVP
401 VYLSSLDYCEAGKAAAVAKTEIEPLRQEASRRNLPSRINQAWVLDADGRL
451 LNTLDACHAPADQLMKFLVELLEPLASEPTDSAAKPVVAPAPQSRPPQAN
501 RDALVLHLTARYLERRGDELVPMRVALGKEVNYFMKGPPAEDWIVLERTE
551 WARLLPAETATVGRSWALDSEVANRMFRHMYPPTEDNDLAKNRIDEAKLT
601 ATIVAMEGGVARARIEGALRMKHRFDPEKDDNRFVNATLLGYLDFEPARS
651 RICSFRLITTEGTYGKNPIGVAVRSVPR

Name Aliases LCA Taxa Group Subgroup
ECFp26149
  • sigma-70 family RNA polymerase sigma factor
  • RNA polymerase sigma factor, sigma-70 family
  • ... more
Singulisphaera acidiphila DSM 18658 ECF57 ECF57s1

>ECFp26149 ECF57 ECF57s1 Singulisphaera acidiphila DSM 18658

1 MAKSGVATRHLHTLFKVGAVGGLSDGQLLERFVTRQGEAAETAFAILVER
51 HGPMVLGVCRRTLANPGDAEDAFQATFLVLVKKAKTVRVDDSLGRWLYGV
101 ACRVAARARTGVLRRQAREGDRLVDRQGPTLDSGCLDLRRVLDEELNRLP
151 EKYRAPVVLCYLEGLTHELAAERLGWPVGTVRGRLSRARERLRTRLSSRG
201 LAPTAAGLWEFPTPTPTEAVSHALIEETVQAAMQYATARLAVGGISTAVA
251 VLTEGAFKTMVLTKLKTSVTLLSAMVAASMIAPAFLAASDPQSVGREQPA
301 TTVGKNEVRKPSKTKNEATETAIRAFGPTHWSANPALAVRYYNHERGYWM
351 YAEEYDRLNDGKQLRLRRFALVTKPRNGQALKTASSDQALIDLSQPLGVP
401 NTWSPLKILQTRLEGNVRINDSQGTPDPANDLAIGPLPYAEFDETSLNIR
451 SESDVTIEGRGMRITGSGLSIQLSPKDETGKDLSIESLTIKNNVKIEIKE
501 LNHSKVVPDQPKAANGQGGRPQGLPPVDGDGSTTKVDSLRDRADQEVTFR
551 FAGSQPMTRP

>ECFp182464 ECF57 ECF57s1 Singulisphaera sp. GP187

1 MAKSESPAVLRDVQTLFSLGTIHGLTDAQLLDRFRSGPDPGSAETAFAGL
51 VARHGSMVMGVCRRALNDPHDVADAFQATFLILVRKAESVEARDSLGRWL
101 YGVSRRVALRAKRTAVRRSARESDGVESLAVLAPQTQEHDLPAILDEEIG
151 RLPEKYRAAVILCDLQGLGQEEAARQLGCATGTVKSRLSRGREKLRSRLI
201 RRGVAPAVVVGAWCGDSIATAVPAAIAEATAKAAIRFAAGQAGAAGVVSA
251 SVIKLTQGVLKTMLFTNIRILFTTTTAIAALATGAGVLARQATAPEPQGA
301 QSADREGAKVQEARDKPETDKAAPSVKEDSNGNDEERNDRIDALQLDIEL
351 LSSELTGIKNSLSQRASAIRSFDGGLGGGRFGGRGGAGEDDPARVRLREM
401 DKQQRESSLKLRETYLEKSKELRQKQRELAKLLSRPQSTVSTPPFVQPGS
451 VASRPSSPVEAKDAPALEQRINAIERKLDEVMTLLKELKR

>ECFp182462 ECF57 ECF57s1 Planctomycetales bacterium 71-10

1 MSRSRVASPVERLFERGTWTGADDARLLERYARRGDREAFEALAARHGPM
51 VLGVCRRILIEPSDVDDAFQATFLVLIRRARSLGPGDVLAAWLHGVATKV
101 ARRARMDRARRRARERDGLAVEPGCEPDSPDFALRGVIDEEVERLPWRYR
151 APVALCYLEGLTHEEAAARLGWPVGSVKGRLARARSMLGPRLARRGVTAG
201 AGALALENLASAAVPAPLVDAVATAAGRVAEGVAWKSVLSYPVVRLAKGA
251 CGAMIATKLTAALTATALVAAAGAGFAAARPEGQEPPADSQPAEPPRQSP
301 GQEAAEDPAEVQRGASGPAGGAPSQPAASATPAVAGAPGPAAKPDESPSE
351 AQAGRLLAASTKAYRSAVEELRRDYRAIDRVYRASRLWLDAQQALATDEQ
401 ARKDAFAEHRARMSVLARIPFPSVAPGDASLPSGADAGAMLAEAELWATR
451 GDAPPRPGDPSGPGTSDGPGDSNPKTAQILAKLDEPLPMNFPNDTPLEDV
501 LKYIKQVVGDAIPVYVEPIGLNQADKTITSPISIDLDGVPLRRTLQLALK
551 QLGLVYYVEDGILVITSPEGAEGGMGAERARPSRRLEEIEKAERGELTLE
601 EMQDLAQKLKLIDEIRKAVKALDDPPPVGGTGGGFQ

>ECFp182461 ECF57 ECF57s1 Planctomycetales bacterium 71-10

1 MRGTVDGLRTLIHAGAIGSLGDGELLDRFVATGEPAAFEAIVRRHGPMVW
51 GVCRRALRDHHDAEDAFQATFLVLARRAEAVRPRDRLVAWLYGVARRTAL
101 KARATRARRRLREGPGEGPEPAATPAEPRDVLAESLDRELARLPERYRLP
151 IVLCDLQGCTHREAAERLGCPIGTLSGRHSRARALLADRLRRRGVALWSG
201 AWLAFAAEDASAATIAKAFACAGRTAAVPSTVAALAREVQGGLLMTKIKT
251 SAAALAMVVAAGMGAVGLAQGKPEEPPPASSPAPKPKPAAKTEDGLAVHT
301 YYVGDIIGADLRPCDERPAEAPDMRPIMDLIASTIAPETWSEWDQPGPSI
351 TPFFLSISLIIRHDRATHERISLLLRQLRRLHDSRLDAPQPSAPPVPLPP
401 PGAVPSTRVATPSPPSPHTVRPVGPRPELVSKSYPIGDLLGIAPGPVEEP
451 NAIPESVWPLVELIAEKVSPESWIHGGGMGGGWARPYYARVLKKSPDGGR
501 TIDPNRPLMLLVRQTEDVQDRVKEFLDGLRLAQGLRKPAP

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more