ECF proteins of ECF subgroup ECF41s42

Displaying ECF 1 - 20 of 25 in total

>ECFp138459 ECF41 ECF41s42 Paenibacillus sp. OV219

1 MEQTEGAGAAAKVYTTYRSLLFALAYRMLGSVMDAEDIVQEAFLAMSEMK
51 VEDVRHPKAYLCKIVTNRCIDRLRSASKQREVYVGPWLPEPLVETSHSVV
101 DEPFSSYMQKESLSTAYLLLLQQLSWVERAVFLLREVLQYEYDEIAEIVG
151 KSSTNCRQIFRRAKLAISGIPEDERELAGVNVQQKETTLVEQFVQALASG
201 NMPQLLSIVKEGAVLYSDGGGKVRAAVRPIVGADRIAAFFFGLQEKQLPE
251 GNSFAFAPVNGATGVIGYAYGQPYFVLTVEIREEQIASLYLVVNPDKLKH
301 VVPINS

Name Aliases LCA Taxa Group Subgroup
ECFp13187
  • RNA polymerase sigma factor SigJ
  • AA76_RS0101585
Paenibacillus ehimensis A2 ECF41 ECF41s42

>ECFp13187 ECF41 ECF41s42 Paenibacillus ehimensis A2

1 MEPAESAGELYVSYKPLLFSLAYRMLGSVMDAEDIVQEAFLYVNETKLDH
51 VQNMKSYLCKLVTNRCIDRLRSASRQREVYVGPWLPEPLVAERDSESEPS
101 LRYLQKESISTAYLLLLQQLSWTERAVFLLREVLQYEYDEIAEIVGKSST
151 NCRQIFHRAKRAVSGLPDPGDERQPVMPAGRREAHLSTEQTGDLIERFVQ
201 ALTAGNLAQLMDVLSADAVLYSDGGGKVTAAVRPIQTAERIARFLEGIMH
251 KLAGSLSIRFADVNGQTGLVSYTDGRISSVISFQTRHNRITGIYLVLNPD
301 KLKHVL

>ECFp14731 ECF41 ECF41s42 Brevibacillus formosus

1 MEALYKQYKGLMFRLAYQMLGSATDAEDIVQDVFVKAHDVSLEQMAEPKA
51 YLCKMTTNRCLDLLKSARKKRELYTGPWLPEPISTPSADSYDSVITKDLL
101 SYAMLVLLERLSPSERAVFVLREAFDFQYDEIAELVGKTEANCRKIVSRA
151 KKKMGIDSAEPHLTPDKELGEEWINRFLAALEHGNVEKLLTLLATDAVLL
201 SDGGGKVTAALHPILSGERVASFLLGLMRSFSKRSDFSVELAPVNDQTGF
251 VIRQDGRIDTVVFLHIEHGVIRNLYFVRNPDKLRFIEP

Name Aliases LCA Taxa Group Subgroup
ECFp19514
  • RNA polymerase
  • PDENDC454_19643
  • ... more
Paenibacillus dendritiformis C454 ECF41 ECF41s42

>ECFp19514 ECF41 ECF41s42 Paenibacillus dendritiformis C454

1 METKGDHSTRSRPDNPVEELYASCRGLAFSIAYRMLGAVSDAEDVVQDVF
51 ADMAGRDLSEVRNRKAYIAKWVTNRCLNILQSARRTREAYPGEWLPEPLA
101 ASGEQPDELAERADSLSYAYLVMLERLTPVERAVFLLREAFEYDYEEIAD
151 IVGKSVPNCRKILSRAKEHARTPSPSAPAGEAARMRSALVTRFVAAFQHY
201 DVEALLELLAEDAVLITDGGPHVRAAMRPLTGQSRVMKLLSSRKTFAAMR
251 HSPPIITDVNGEPNAVYLDQGAIRAVCCFMLTPDQERILQVYIILNPDKL
301 DHLARKQGS

>ECFp19405 ECF41 ECF41s42 Paenibacillus sp. Soil724D2

1 MELAGSSEQVYTSYKPLLFSLAYRMLGSVMDAEDVVQEAFLYVSETKLAH
51 VNNPKAYLCKIVTNRCIDKLRSASKKREVYVGPWLPEPLIMSADNQTEPD
101 RYYSQKESLSTAYLLLLQQLSWVERAVFLLREVLQYEYDEIAEIVGKSST
151 NCRQIFRRAKSAISSFPDRGGDPKVLQKQPVMEQTSAVVEQFVQALVSGN
201 IGQLLSIVKTDAVLYSDGGGKVKAAVKPIMGAERIAMFMSGLLSKVPPGF
251 SYSLATVNGQMGIVAYDDGLPYNVISFHVVDGQIAAIYFVINPDKLRHI

Name Aliases LCA Taxa Group Subgroup
ECFp18667
  • RNA polymerase sigma factor SigJ
  • SD71_07610
  • ... more
Cohnella kolymensis ECF41 ECF41s42

>ECFp18667 ECF41 ECF41s42 Cohnella kolymensis

1 MERVHSDRSEQLYQLYKPLLFSLAYRMLGSVSDAEDIVQEAFLSWSERRP
51 ETVLNEKAYLCKMVTNRCVDRLRSPGKQREVYVGPWLPEPLITEALDSDS
101 PSGAYLQKESLSTAYLLLLQQLSWVERAVFILREVLQYEYDEIAEIVDKS
151 SSNCRQIFHRAKRSVSGLSGMADTVPLKSESLKALIEQFIHAVASGNTGQ
201 LMNLLKADVSMHSDGGGKVTAAVRPILGADRVIAFLMGIASKAPADMSFR
251 IQMVNGNPGIVSYIGEQPSSVITFRMENDRIAEIYIVVNPDKLKHLPQR

Name Aliases LCA Taxa Group Subgroup
ECFp18561
  • RNA polymerase sigma factor SigJ
  • PM3016_389
  • ... more
Paenibacillus mucilaginosus 3016 ECF41 ECF41s42

>ECFp18561 ECF41 ECF41s42 Paenibacillus mucilaginosus 3016

1 MENGTVAEQAYTTYKPLLFSLAYRMLGSVMDAEDIVQDAFLSLDAAGPEP
51 IRNLKAYLCRVVTNRCIDRLRSAQKQREVYVGPWLPEPLLTDGDPSGNPP
101 EQYMLQESVSTAYLLLLQQLSSTERAVFLLREVLLYDYEEIASIVGKSQA
151 NCRQIFHRAKRSIGGSASFDSGGDVCLAAPRPAAGQEARQLIEGFLTALA
201 TGDVPKLLSSLSEDASLFSDGGGRVTAAVRPILGADRIIRFLTGLLEKSP
251 PGFSYRPALVGGDPGLVTYIHGEPSSVMSFEVAGGQIRAIYIVVNPEKLQ
301 HVR

Name Aliases LCA Taxa Group Subgroup
ECFp18352
  • RNA polymerase sigma24 factor
  • AA69_RS0119860
Brevibacillus agri 5-2 ECF41 ECF41s42

>ECFp18352 ECF41 ECF41s42 Brevibacillus agri 5-2

1 MEALYQQYKGLLFHLAYQLTGSSTDAEDIVQDVFLKAHGVALEQIAEPKA
51 YLCKMTTNRCLDLLKSARHKRELYTGPWLPEPIPTPEADSYDAVVTKDLL
101 SYAMLVLLERLSPAERAVFVLREAFGFDYAEIAGLVDKSETNCRKLISRA
151 KGKLGIAPDAPIRAKETELGEQWMSRFLAALEQGNVTALLALLSADAELL
201 TDGGGKVSAAIRPIVSGERVARFLLGLSARFAQNASFAIELAPLNGQVAL
251 VIRQDGEVDTVVFPHLQNGRLYRLYFVRNPDKLQAVRS

>ECFp11715 ECF41 ECF41s42 Brevibacillus brevis X23

1 MEALYKQYKGLMFHLAYQMLGSATDAEDIVQDVFVKAHAVSLEQMPEPKA
51 YLCKMTTNRCLDLLKSARKKRELYTGPWLPEPISTPDADGYDSVITKELL
101 SYAMLVLLERLSPPERAVFVLREAFDFQYDEIAELVGKSEANCRKIVSRA
151 KKKMGMDPEAPHFTPEKELGRFLSALEHGNVETLLTLLATDAVLLSDGGG
201 KVTAALHPILSGKRVASFLLGLMRSFSKRPDFSVELAPLNNETGFVIRQD
251 GKIDTVVFLHIEHGVIRNLYFVRNPDKLRFIVS

>ECFp17900 ECF41 ECF41s42 Paenibacillus elgii B69

1 MTQLPLEDWYTEYKSLLFSIAYRMLGSVSEAEDIIHDLFLAVSRTDPGAI
51 QNPKAYLCKSVTRRCIDQLKSARSRREVYVGPWLPEPLQTSDKEDPLLHA
101 ARNEDISFAFLLLLEQLNPVERAIFVLREAFDYDYKEIADMLDKSEAACR
151 KTYSRLKQKLHPEEALLPQPDIAESESLVRSFLKAVSTGDVLQFVHLLTE
201 DAVLYSDGGGKVRAALRPILGADRIAAFLLGIASKGTVLTRSVPVSFNGG
251 AGLLVDGSRSRIAMLFEFEGTRIRTMYFVNNPDKLSHLKEFPSFS

Name Aliases LCA Taxa Group Subgroup
ECFp17717
Paenibacillus elgii ECF41 ECF41s42

>ECFp17717 ECF41 ECF41s42 Paenibacillus elgii

1 MTQLPLEDWYTEYKSLLFSIAYRMLGSVSEAEDIIHDLFLAVSRTDPGAI
51 QNPKAYLCKSVTRRCIDQLKSARSRREVYVGPWLPEPLQTSDKEDPLLHA
101 ARNEDISFAFLLLLEQLNPVERAIFVLREAFDYDYKEIADMLDKSEAACR
151 KTYSRLKQKLHPEEPLLPQPGIAESESLVRSFLKAVSTGDVLQFVHLLTE
201 DAVLYSDGGGKVRAALRPILGADRIAAFLLGIASKGTVLTRSVPVSFNGG
251 AGLLVDGSRSRIAMLFEFEGTRIRTMYFVNNPDKLSHLKKLPEL

>ECFp172086 ECF41 ECF41s42 Paenibacillus

1 MEHEMSTEQLYEAYKPLLFALAYRMLGSVMDAEDMVQEAFLSLNRGDAVR
51 IRNMKSYLCKVVTNRCLDRLRSASRQREQYIGPWLPEPLIGEEQLHGDPE
101 EGYLLKESVTTAYLLLLHQLSAVERAVFLLREVLQYEYDEIADMVGKSPT
151 NCRQIFHRAKRSLGSRPAPAEPRAASASAAANEPVNSGPALPLRSDALAA
201 KRLVEQFVQALTAADVPRLLALLAEDAVLYSDGGGKINAAVRPILSAGRI
251 AQFLLGLLGKVPEDFAVRPAIVNGVPGLISYGGHMPINTVSFHLKDGVIE
301 GIYLVVNPDKLEHVPRLLS

Name Aliases LCA Taxa Group Subgroup
ECFp16897
Paenibacillus sp. A3 ECF41 ECF41s42

>ECFp16897 ECF41 ECF41s42 Paenibacillus sp. A3

1 MTQLPLEDWYTEYKPLLFSIAYRMLGSVSEAEDIIHDLFLAVSRTDPGAI
51 QNPKAYLCKSVTRRCIDQLKSARARREVYVGPWLPEPLQTPDKEDPLLQA
101 ARNDDISFAFLLLLEQLNPVERAIFVLREAFDYDYKEIAEMLDKGEAACR
151 KTYSRLKQKLHSAEACPPQPRLPESESLVRSFLKAVSSGDVLQFIHLLTE
201 DAVLYSDGGGKVRAALRPILGADRIAAFLLGIASKGTVLTRSVPVSFNGG
251 AGLLVDGSRSRIAILFEFEGMRIRTMYFVNNPDKLSHLPEPSEL

Name Aliases LCA Taxa Group Subgroup
ECFp16528
  • hypothetical protein
  • AA76_RS0122390
Paenibacillus ehimensis A2 ECF41 ECF41s42

>ECFp16528 ECF41 ECF41s42 Paenibacillus ehimensis A2

1 MTQLPLEDWYTEYKPLLFSIAYRMLGSVSEAEDIIHDLFLAVSRTDPGTI
51 QNAKAYLCKSVTRRCIDQLKSARARREVYVGQWLPEPLQTPDKEDPLQQA
101 TRNDDISFAFLLLLEQLNPVERAIFVLREAFDYDYKEIADMLDKSEAACR
151 KTYSRLKQKLNVAEALPPQPSLPESQSLVRSFLRAVSTGDVLQFIHLLTE
201 DAVLHSDGGGKVRAALRPILGADRIAAFLVGIASKGTVLTRSVPVSFNGG
251 AGLLVDGSRSRIALLFEFEGTRIRAMYFVNNPDKLSYLPEPPEL

Name Aliases LCA Taxa Group Subgroup
ECFp15152
Paenibacillus sp. A3 ECF41 ECF41s42

>ECFp15152 ECF41 ECF41s42 Paenibacillus sp. A3

1 MEDWYTEYKPLLFSIAYRMLGSVSEAEDIIHDLFLAVSRTDPGAIQNPKA
51 YLCKSVTRRCIDQLKSARARREVYVGPWLPEPLQTPDKEDPLLQAARNDD
101 ISFAFLLLLEQLNPVERAIFVLREAFDYDYKEIAEMLDKGEAACRKTYSR
151 LKQKLHSAEACPPQPRLPESESLVRSFLKAVSSGDVLQFIHLLTEDAVLY
201 SDGGGKVRAALRPILGADRIAAFLLGIASKGTVLTRSVPVSFNGGAGLLV
251 DGSRSRIAILFEFEGMRIRTMYFVNNPDKLSHLPEPSEL

Name Aliases LCA Taxa Group Subgroup
ECFp15052
  • RNA polymerase sigma factor SigJ
  • G519_RS0109425
Paenibacillus alginolyticus DSM 5050 = NBRC 15375 ECF41 ECF41s42

>ECFp15052 ECF41 ECF41s42 Paenibacillus alginolyticus DSM 5050 = NBRC 15375

1 MELAGFSEQVYTSYKPLLFSLAYRMLGSVMDAEDVVQEAFLYVNETNPAH
51 VNNPKAYLCKIVTNRCIDKLRSASKKREVYVGPWLPEPLIMSADNQTEPD
101 LYYSQKESLSTAYLLLLQQLSWVERAVFLLREVLQYEYDEIAEIVGKSST
151 NCRQIFRRAKSAISSFPDREADPKAQDKQPIVEQTSAVVEQFVQALVAGN
201 IGQLLSIVKADAVLYSDGGGKVKAAVRPIMGAERVAMFMSGVLAKVPPGF
251 SYSLATVNGELGIVAYDDGQPYNVTSFHVVDGQIAAVYLVVNPDKLRHL

>ECFp14816 ECF41 ECF41s42 Paenibacillus mucilaginosus K02

1 MENGTVAEQAYTTYKPLLFSLAYRMLGSVMDAEDIVQDAFLSLDAAGPEP
51 IRNLKAYLCRVVTNRCIDRLRSAQKQREVYVGPWLPEPLLTDGDPSGNPP
101 EQYMLQESVSTAYLLLLQQLSSTERAVFLLREVLLYDYEEIASIVGKSQA
151 NCRQIFHRAKRSIGGSASFDSGGDVCLAAPRPAAGQEARQLIEGFLTALA
201 TGDVPKLLSSLSEDASLFSDGGGRVTAAVRPILGADRIIRFLTGLLEKSP
251 PGFSYRPALVGGGPGLVTYIHGEPSSVMSFEVAGGQIRAIYIVVNPEKLQ
301 HVR

>ECFp14784 ECF41 ECF41s42 Paenibacillus sp. 1ZS3-15

1 MEITGAEASEQIYLSYRPLMFSLAYRMLGSVMDAEDVVQEAFLYANETNL
51 DHVHNPKAYLCKIVTNRCIDNLRSASKNREVYIGPWLPEPLVTLSTDHQI
101 APDLAYSHKESLSTAYLLLLQQLSWVERAVFLLREVLQYEYDEIADIVGK
151 SSANCRQIFRRAKNAISLPQEERASETKLPLKSQDVKQMTAVVEQFVQAL
201 VSGNIAQLLTIVKSDAILYSDGGGKVKAATNPILGAERIAMFLSGILAKL
251 PEGYHANLMTVNEQTGLVAYVNNQPHNVMTFQLEDGQIKSFYLVVNPDKL
301 KHLEIGQTEA

>ECFp14637 ECF41 ECF41s42 Paenibacillus sp. Root444D2

1 MELAGSSEQVYTSYKPLLFSLAYRMLGSVMDAEDVVQEAFLYVSETKLAH
51 VNNPKAYLCKIVTNRCIDKLRSASKKREVYVGPWLPEPLIMSADNQTEPD
101 RYYSQKESLSTAYLLLLQQLSWVERAVFLLREVLQYEYDEIAEIVGKSST
151 NCRQIFRRAKSAISSFPDRGGDPKVLQKQPVMEQTSAVVEQFVQALVSGN
201 IGQLLSIVKTDAVLYSDGGGKVKAAVKPIMGAERIAMFMSGLLSKVPPGF
251 SYSLATVNGQMGIVAYDDGLPYNVISFHVVDGQIAAIYLVINPDKLRHI

Name Aliases LCA Taxa Group Subgroup
ECFp138555
Bacillus sp. NSP2.1 ECF41 ECF41s42

>ECFp138555 ECF41 ECF41s42 Bacillus sp. NSP2.1

1 MEALYQQYKGLLFHLAYQLTGSSTDAEDIVQDVFLKAHGVALEQIAEPKA
51 YLCKMTTNRCLDLLKSARHKRELYTGPWLPEPIPTPEADSYDAVVTKDLL
101 SYAMLVLLERLSPAERAVFVLREAFGFDYGEIAGLVDKSEANCRKLISRA
151 KGKLGIAPDAPIRAKETELGEQWMSRFLAALEQGNVTALLALLSADAELL
201 TDGGGKVSAAIRPIVSGERVARFLLGLSARFAKNASFAIELAPLNGQVAL
251 VIRQDGEVDTVVFPHLQNGRLYRLYFVRNPDKLQAVRS

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more