ECF proteins of ECF subgroup ECF41s41

Displaying ECF 1 - 20 of 26 in total
Name Aliases LCA Taxa Group Subgroup
ECFp19723
  • hypothetical protein
  • EL26_RS06885
Tumebacillus flagellatus ECF41 ECF41s41

>ECFp19723 ECF41 ECF41s41 Tumebacillus flagellatus

1 MLFTLAYRLLGTVMDAEDMVQETFVAYAGIEETQEIHNQRAYLCKMLTNR
51 CLDFLRSAKHRREVYVGPWLPEPIVWRDDREDHDPLRELLSRDDLTMAYL
101 LMMETLTPTERAVLVLREAYQYEYAEIASLVEKSETNCRKIHSRVKQKLH
151 PDAADRRVDYAKDQAVLTRFLTAFTTGDTAALMQVLTEDVTLLSDGGGKA
201 VAAIHPIVSSTRVLAFLQGIFSKTPSNGTYEWVTINSQPGLLLKIGAEVV
251 GTLSFEREGERISKLFMVRNPDKLARIT

Name Aliases LCA Taxa Group Subgroup
ECFp11289
  • hypothetical protein
  • JCM10596_RS06315
Bacillus mannanilyticus JCM 10596 ECF41 ECF41s41

>ECFp11289 ECF41 ECF41s41 Bacillus mannanilyticus JCM 10596

1 MLEMEKLYEEYRPLLFSLAYQMLGSVMDAEDIVHDTFLSLDNKKGEEIQH
51 IKAYLCRMVTNRCLDYLKSARKKRELYIGPWLPEPLLTEAMEEPLQKYLQ
101 KDRISIAFLLLLEKLSPPERCIVVLRDSFSYTFDEISAIVDKTTANCRQI
151 YRRAKAKIHSEGAGNFSDELEESMLRKKGENQVDSSLLEQLVLAILQGEP
201 EKLSQLLAEDVVAYSDGGGKVKAALQPIYGADRVSRFLLGISSKRTPDIT
251 FRPTTINGSPGLVFYVKESLWSMVAIEMKRERIQAIYLLMNPDKLSLLSL
301 SEQQAKLT

Name Aliases LCA Taxa Group Subgroup
ECFp138585
  • hypothetical protein
  • VJ09_RS16835
Risungbinella massiliensis ECF41 ECF41s41

>ECFp138585 ECF41 ECF41s41 Risungbinella massiliensis

1 MNLEMTYQVYKPMLLSIGYSLLGTISEAEDIVQEVFLNLQSIDLDHIDNL
51 KAFLCKSVTNRCFNLLQSANKKKVIYPGTWLPEPMPSMTMDEAFSRIERK
101 EDLSYAYMVMLESLSPMERVVFVLKDLYDYPYRKIAEMMQKSEDNCRKIC
151 SRARQKLKEYRPDHCRHENHSMVVTKFINAINNDQVEEVIKLLGEQVIFI
201 SDAGGKVRAAVRPITGIERVTAFFKGIATKGSFSKAASSISINGETAMKL
251 IREGLPSIWSFELEPESGRISYIYAVFNPDKLKPFID

>ECFp19739 ECF41 ECF41s41 Paenibacillus sp. Leaf72

1 MADTQVLWKVAEWYADYKSLLSSLAYKLLGSRQEADDVVQDVFVTLQSAE
51 PSPLRNVKAYLCKMTVNRCMNVLQSARHKREAYVGEWLPEPWSGDYGDEP
101 LEQLARRETISYAMLVMLEHLSPLERAVFVLREGYGYGYDELAELVGKSE
151 SNCRKILSRAKLALDQYRLLPQSDAEEQELTVDAAALEPFVAAFEQADIG
201 KLLALMRQDAVFITDGGGKVTAVRRPVISARRAVILLRRMSTHSLHGTNI
251 SISMLNGQPALIFRRGKEVQAVMCLEWVQTEEGSRIKRIYVMYNPDKLSF
301 I

Name Aliases LCA Taxa Group Subgroup
ECFp18347
  • hypothetical protein
  • RNA polymerase
  • ... more
Thermoactinomyces vulgaris ECF41 ECF41s41

>ECFp18347 ECF41 ECF41s41 Thermoactinomyces vulgaris

1 MEYETLYATYKPLLISVAYRMVGTLADAEDLVHDVFVNIQRNDVGLIRHP
51 QAYLIKLVTNRCLNFLTSARHKRETYVGPWLPEPLQSSGDHADPATEVIQ
101 QETMAYGLLVMMELLSPVERAVFVLREALGYTHAEIARVLGKSEANCRKI
151 YSRAKTKLQTSSGLPSYKSAQAETLAQAFQQAVHTGKFDRFIDLLTEHAV
201 LLSDGGGKVRAAIQPIIGRERIRAFLEGITKKGAFNGTLYQVTLNGQPGL
251 LLIKNGQQAVSMAISFAPHENGTQATHIFLVNNPDKLQHLSHLGILPQD

>ECFp11610 ECF41 ECF41s41 Paenibacillus swuensis

1 MSDYHTLYDEYRPLLFHIAYRMLGLSQDAEDIVQDVFVSLQQQNTVEITN
51 MKAYLCKLVSNRCLNELKSSRKAKTTYIGPWLPEPIVTAAEGNPEKSLEL
101 QDDIAYAYLVVMERLTPMERTVFVLRETLGFAFKEIGEWIGTSEVNCRQL
151 FSRGKRKLDAKVNDPGVPISRIKPESRALSVSFSTAFRAGDIPAIVELLS
201 EDAIMHTDGGGIVKAAINPIIGRSRVKDLLAFSISNYLRTGTFKKVLVNG
251 QESFMVLYDGKPHAVYTLVVTPDGTAVSRVYVMMNPHKLLGVARLLERQS

Name Aliases LCA Taxa Group Subgroup
ECFp19595
  • hypothetical protein
  • F556_RS0108580
Paenibacillus daejeonensis DSM 15491 ECF41 ECF41s41

>ECFp19595 ECF41 ECF41s41 Paenibacillus daejeonensis DSM 15491

1 MLSSAYTTYRPLLLSIAYRMLGSVSDAEDVVQDVFVTLSAKHAVAGDEEE
51 EHQWKPYLCKIVTNRCLDLLRSARRKRELYVGPWLPEPLVQELPDRDHCD
101 PLQTIELEDSISYAVMVMLQHLTPTERAVFILREAFGFAYSEIGEILGKT
151 ELGCRKIYSRLRKKIQGMQPEEDNVAEASELLHRFMHAAISGDLGGLIDL
201 MHEDIAAQTDGGGKIAAATRVIASRPNVAAFIMGLAKRLDETTRARPVLV
251 NGLEGLLVVSQDGLGDAVISLAFRDHRIQHIYMVRNPDKLRHIRLG

Name Aliases LCA Taxa Group Subgroup
ECFp17611
  • RNA polymerase sigma24 factor
  • K332_RS0120750
Paucisalibacillus globulus DSM 18846 ECF41 ECF41s41

>ECFp17611 ECF41 ECF41s41 Paucisalibacillus globulus DSM 18846

1 MEELYNQYRPLLFTLAYQMTGSSMDAEDLVQDVFMKLHHIDIGKLDNPKA
51 FLCKMVTNKCLDYLTSARKKREQYVGVWLPEPVVVSDDISDLVADKDLLS
101 YVMLVLMERLTPIERAIFLLKEAYAFDYRTIASFVDKSEVNCRKIYSRAK
151 MKLGEKEEAKMKLDNHWMNDLLTALREGNVEKLLPLISEDITVYSDGGGK
201 VPAALYPIQTPERVLRFLGGLLNRLPLFGVDARMERIMINREEGIIVRTD
251 KDIILVAMFNVQMNLVNNIYFIRNPDKLEMLRKQLI

Name Aliases LCA Taxa Group Subgroup
ECFp18170
  • RNA polymerase
  • M657_RS0100965
Bacillus megaterium MSP20.1 ECF41 ECF41s41

>ECFp18170 ECF41 ECF41s41 Bacillus megaterium MSP20.1

1 MEFKKMYKEYQPYLFSIAYRMLGSVTDAEDIVHDSLLQMNQKTAHIKDLK
51 SYLAKTTTNHCINFLKSARTQRETYTGTWLPEPQVHFIKQPLDKVITDEA
101 ISYAFLVLMEQLTPTERAVFVLKEAMAYHYVEIANIINKTEVNTRKIYSR
151 AKKKLQNDLFSAHTNHADRAENLTKSFLDATTTGDFDEFIHVLTEDVVLV
201 TDGGGKVLAAIYPILNKRRVSAFLKGIFSKGSFSGKLYAVIVNGQQGILQ
251 VKDGRPVKIITFALDRSQKNISRIYIVSNPDKLNRISIPRH

Name Aliases LCA Taxa Group Subgroup
ECFp12256
  • hypothetical protein
  • WH37_RS25240
Paenibacillus algorifonticola ECF41 ECF41s41

>ECFp12256 ECF41 ECF41s41 Paenibacillus algorifonticola

1 MADTQVLWQVAKWYADYKTLLSSLAYKLLGSRQEADDVVQDIFVTLQSAE
51 PYPMRNVKAYLCKMTVNRCMNRLQSARHKREAYVGEWLPEPWSGEYGDGP
101 LEQLARRETISYAILVMLEHLSPLERAVFVLREGYGYGYDELAELVGKSE
151 ANCRKILSRAKQALELYRQLPESQVEEQELTVDASALEPFVAAFEQADIG
201 KLLALMRQDAVLYTDGGGKVTAARRPIISARRAVLLLRRMSTHSLHGTSI
251 SVSIMNGQPALVFRRERAVQAVMCLEWVQTEVGSRIKRIYTMYNPDKLSF
301 I

>ECFp14503 ECF41 ECF41s41 Bacillus sp. FJAT-25509

1 MEVDYLYSQYKPLLFSIGYSMLGSVEDSEDLVQDTFLTVHKMNQSITKEE
51 PNNIKAFLCKVMTNRCLDLLKSSKNKREVYIGPWLPEPIIQNLPEDLHDD
101 PMEKMILDETITYAFLVLLEQLNPIERAVFVLREAFQFDFRTIANILNKT
151 ELNCRKIFSRLQRKVQSKDGVEKRNLNQELTIAKRFIEAAETGNLEMLIS
201 LLTEDIVLITDAGGKTKAALRPINLQKNVIAFLVGVRKKINSPSEIEIAL
251 INNQIGLIVKSEGEEPTVICFEIEGDRYRSIYMLRNPDKIRLLG

>ECFp172049 ECF41 ECF41s41 Paenibacillus tianmuensis

1 MLDYHALYEQYHQLLFSIAYRMLGLAQDAEDVVQDVFVSLQHHNSGEIAN
51 MKAYLCKLVTNRCLNELKSSHKAKTTYIGPWLPEPIVTAVEGNPAEALAL
101 QDDIAYAYLVVMQRLTSAERAVFVLRETLGFTFEDIGEMIGKSAVNCRQL
151 FSRGKRKLDIQKNDASVPIAPLNPEAEALSASFSAAFRAGDIASIVELLS
201 EDAILLTDGGGKAKAAVNPIYGRDRVRALLAFSISRYLRNGVIRSVVVNG
251 HNSFMVMHGGKPFGVYALAFTPDGSAISRVYVMMNPDKLNSAARLLELPS

Name Aliases LCA Taxa Group Subgroup
ECFp16291
  • RNA polymerase
  • PSHG_RS20580
Paenibacillus senegalensis JC66 ECF41 ECF41s41

>ECFp16291 ECF41 ECF41s41 Paenibacillus senegalensis JC66

1 MQDFDAVYKNYRSFLFSIAYQMLGTISDAEDVIHDVFHLLQHKANLDQVK
51 DLKAYLAKMTTNRCLNLLRSARKRREVYTGEWLPEPQVSHFDTPADKVMT
101 GEAVSYAFLVMLDLLSPLERAVFILREALEFSYDDIAPIIEKTESNTRKI
151 YSRAKQKLQKDIPAHPQRSEQVDLLADAFLKAASTGQFTELIDLLTEDVV
201 LVSDGGGKVRAAIQPIVSKTRVAAFLTGISGKGSFLGEIYPVMVNGQKGV
251 LQVLEGKPKKVICFEGSADRGLIQTIFIMLNPDKLKHVVTP

Name Aliases LCA Taxa Group Subgroup
ECFp15225
  • hypothetical protein
  • F556_RS0112335
Paenibacillus daejeonensis DSM 15491 ECF41 ECF41s41

>ECFp15225 ECF41 ECF41s41 Paenibacillus daejeonensis DSM 15491

1 MADPIEEERIERWYREYQPLLTAVAYRMLGSHSEAEDAVQDVFVTLSRQT
51 ELEIEHPRAYLIKMVTNRALNMMKAAPRSREHYPGLWLPEPILDSVQDDG
101 PQTQLLQRERLGYALLVLLQTCTPPERAVYVLRESVGCDYKEIAEMLGKT
151 EAACRKIYSRAAAKLGVMTLSEDSTRLDNAMDRFVQAFTTAVNSGSFDGF
201 LRLIAEDATLLSDGGGIVRSALRPILGRERIAAFFTGIARKGSLIGRLRP
251 IRLSGQSGLLLERAGLLPMAFALEPVPDGSAIGAIYLISNPHKLGRATGT
301 LPKWL

Name Aliases LCA Taxa Group Subgroup
ECFp14900
  • RNA polymerase sigma factor SigJ
  • BTHG_RS17250
Bacillus timonensis ECF41 ECF41s41

>ECFp14900 ECF41 ECF41s41 Bacillus timonensis

1 MLDKQFYLEYKPLLFSIAYRMTGTITEAEDIIHDVLIDFEKKDRDQIENL
51 KAYLCKMVTNRSIDYLKSARKQREVYIGPWLPEPLIIHDVDPIQVVLMKD
101 NLSYALLSLMEQLSPVERAVFVLREAFGYGYDEISTIMDKDVTNCRKILS
151 RARKKVDYKEDINNLQVNQEELQHLVHSFLLAATTGNIESLLSMLANDVS
201 LYSDGGGRVKAAIVPIKTKDRVAKFIFGLIRKFGQDDNLEIELVTVNGQS
251 GILIKRNHKPENVVCFEIEKNQIKQLFLIRNPEKLTYALKGVQF

>ECFp138690 ECF41 ECF41s41 Thermoflavimicrobium dichotomicum

1 MKIESLYQTYKPLLFSIAYHMLGSVSDAEDVVQECFLAVYQLDEDTIRDM
51 KAYLSKMVTNRCINLLKSARKKREVYVGEWLPEPLVQDVKHGPQDQVECE
101 ETISYAVLILLENFSPPERAVFVLREVFGYTYREIASILERSEASCRKIY
151 SRLKQRMQQLDPATDSIKIKHEGKRVKEFINALVDGKIEKILELLTEDVV
201 FISDGGGKVKAAINPIVGRSRVLALLGGIAKRFVHIEAHLQMINGQVGIL
251 FIRENEIVAVMCFDMDPKTERFQKIYFVLNPDKLKHIHL

>ECFp138092 ECF41 ECF41s41 Lihuaxuella thermophila

1 MSFIEITPTFYQTYKPLLFSLAYRLLGSVTDAEDMVHEIFISCEKVKRGQ
51 VEDVKAYLCKMITNRCLDYLKSARKQRESYMGPWLPEPIIIDEETERPDR
101 RVLTREYLSIAYLVLMERLTATERAVFVLREVFQFDYREIAEIVEKSEEN
151 CRKIFSRAKQKLDARDPEPSANYKQHKGILERFVQAIQAGDKEAMLRLLS
201 KDVILYTDGGGKVKAAINPIQSSNRVLLFLQGVYSKNSKLDHSVIVNLNG
251 TPGLLLFRGEELDSTLCCKFTDQKIEAIYIVRNPDKLHHIRNHIGMTRKK
301 ST

>ECFp13682 ECF41 ECF41s41 Brevibacillus laterosporus DSM 25

1 MEYNSRFNNLKVEELYLSFKPYLISIAYRMLGSLTDAEDIVQDTFIKLQG
51 SDIPQINNVKSYLSKMVTNRCINEIKSVRKKREAYLGTWLPEPIVHGQLV
101 DPSEKMIQDDSLSYALIILMEKLSAMERAVYVLRKAFQFEHPEISSMLNI
151 TEVNCRKIFSRAKKKIKDLSEKSRIPYQVQEDHTDRFISALSKGNIQEIT
201 DILADNVTFLADGGGKVVTAINEIVSKERVLTLLHAIATKFFTGKTAHVV
251 NVNNQKGIIIVKDGKPIGVFSFVWNPNTHKIHQLFYVVNPAKLQKINIS

>ECFp173056 ECF41 ECF41s41 Bacillus caseinilyticus

1 MSNGEILYQQYKPLLFSIAYRMIGSVTEAEDIVQETYLTFLQLDQQAITD
51 KKAYLCKMAANLCLDTLKSARKKRETYVGPWLPEPLITKAAATPEDKVIE
101 QESLSVSYLFLMEKLSPAERAVFIFREVFAFNYREIASMVDKTEANCRKI
151 FTRAKGKIDRHQTPSHLSYEKNQQVIGDFLHAFKNGDTEKVLSLVSEDVI
201 LYSDGGGVVKAALKPIETRDRVLAFLTGIAAKAPKGLQTLPQSINGQPGI
251 IHAIGTKIYNAVSFTVYEQRIKQIFIILNPEKLNHLSCFAPIS

>ECFp12487 ECF41 ECF41s41 Bacillus sp. JCM 19034

1 MPLTQLYNEYKSLLFSIAYRMVGTIADAEDIVQDVFVRLSQLDIASIDHI
51 KGYLVKMTTNRCINLIQSNERTREVYPGPWLPEPFSNGTSSAKQEIQDVS
101 VSLEKWEQVQYALLATLQTLNAQERAVFILRETFSYSYREIADIIGKSES
151 NCRKICSRSRLKMKKSCPNLTSAPVSKTESNKRYIEAFICALQYGDMEPL
201 IEKLLDDIVLITDGGGKVRAAYNPIIGIERVRAFLTGVRHKGSFDGDFSL
251 IELNGEWAILLKQNDQPKMIFLFHIDQKDKGLRRIFILLNPDKLSV

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more