ECF proteins of ECF subgroup ECF41s40

Displaying ECF 1 - 20 of 26 in total

>ECFp14764 ECF41 ECF41s40 Acinetobacter sp. NIPH 298

1 MQNQQNLTTHDLDLFQASRAFLFGLAYRLLGSTHDADDVLQDIFLKWQMQ
51 PKEEILNPQAWLTSVCTRHCIDLLRSHHKSRTEYVGTWLPEPYQHTEQIS
101 IESDYTLSTAFLLVLEKLSPKERAAYLLHDIFNLDYQEVSEILQEQHSYC
151 RQLVVRGRKRISEQPKVLSTLPTSHQMTLLNAFRDAIHSHNLDQLKKLLS
201 EDIQLAADGGGKVSAIPQPLIDQPSVLRFLSACSFRLGMSFFGKYAISMA
251 ILALSYMINNIIV

>ECFp19611 ECF41 ECF41s40 Acinetobacter sp. ANC 3929

1 MKASGTISQHDLTIFETSRTFLFGLAYRLLGTTSDAEDVLQDIFIKWQQQ
51 PRQDIINPQAWLTSVCTRHCIDLLRAHHRSRTEYTGTWLPEPYHHTETFS
101 VESDYTLSTAFLLVLEKLSAKERAAYLLHDIFNLDYIEISEILREQQSNC
151 RQLVARSRKHIADEPNVLSNHPTQQQIKLLNAFKVAIHSHDLNQLTQLLS
201 DDIQFAADGGGKVSAIRQPFIGQPPILRFFERLLFQAWTELSWEMCHLNG
251 SVGFKLYDSNYCCVMVLTFAFNDQQQLQSIYSLRNPDKLK

>ECFp18072 ECF41 ECF41s40 Acinetobacter haemolyticus

1 MNKSTNFSQDDLNLFQASRTFLFGLAYRLLGSTSDAEDALQDIFIKWQQQ
51 PKHEIIHPQAWLTTICTRHCIDLLRSHHKSRTDYIGTWLPEPYHHTEELL
101 AESDYTLSTAFLLILEKLSVKERAAYILHEIFNLDYAEIADILLEQQNYC
151 RQLVTRSKKRIAEQPKVLSTIPTSHQITLLNAFKDAIHSHNLEQLKALLS
201 EDILFAADGGGKVSAIRQPFTDLNSVLRFFERLLFQAWTELSWEMCYLNG
251 NIGFKLFDQQHHCVIVLTFHFDQQHISDIYVLRNPEKL

>ECFp16450 ECF41 ECF41s40 Acinetobacter venetianus

1 MNTTTNFSNEDLKLFQVSRTFLFGLAYRLLGSVHETEDVLQEIFIKWQQQ
51 PKQDIINPQAWLTAVCTRHCIDLLRSHHKSRTEYIGTWLPDPYDQSEDLS
101 IESDYTLSTAFLLVLEKLSAKERAAYLLHDIFNFDYIEISEFLQETQSYC
151 RQLVTRGRKHIKAEPKILSTLPTSRQLVLLDAFKHAVHSQNIGRLKELLS
201 EDILFAADGGGKVSAIRHPFIGQSNVLRFFERLLFIAWNELSWKICLLNG
251 NLGFKLYDHNQTYVTAITFSFNQSQISDIYVLRNPEKLK

>ECFp11684 ECF41 ECF41s40 Acinetobacter venetianus

1 MFGLAYRLLGSVHETEDVLQEIFIKWQQQPKQDIINPQAWLTSVCTRHCI
51 DLLRSHHKSRTEYIGTWLPEPYDQSEDLSIESDYTLSTAFLLVLEKLSAK
101 ERAAYLLHDIFNFDYIEISEFLQETQSYCRQLVTRGRKHIKSESKVLSTI
151 PSSRQLVLLHAFKDAVHSQNIGRLKELLSEDIQIAADGGGKVSAIRHPFI
201 GQSDVLRFFERLLFIAWNELSWEICLLNGNHGFKLYDNNHSYVTAITFSF
251 NQSQISDIYVLRNPEKLK

>ECFp17397 ECF41 ECF41s40 Acinetobacter

1 MNTTTNFSNEDLKLFQASRTFLFGLAYRLLGSVHETEDVLQEIFIKWQQQ
51 PKQDIINPQAWLTSVCTRHCIDLLRSHHKSRTEYIGTWLPEPYDQSEDLL
101 IESDYTLSTAFLLVLEKLSAKERAAYLLHDIFNFDYIEISEFLQETQSYC
151 RQLVTRGRKHIKAEPKMLSTLPTSRQLVLLDAFKDAVHSQNIGQLKELLS
201 EDIQFAADGGGKVSAIRHPFIGQSNVLRFFERLLFIAWNELSWKICLLNG
251 NLGFKLYDHNQTYVTAITFNFNQSQISDIYVLRNPEKLK

>ECFp19124 ECF41 ECF41s40 Acinetobacter

1 MNTTTNFSNEDLKLFQASRTFLFGLAYRLLGSVHETEDVLQEIFIKWQQQ
51 PKQDIINPQAWLTSVCTRHCIDLLRSHHKSRTEYIGTWLPEPYDQSEDLL
101 IESDYTLSTAFLLVLEKLSAKERAAYLLHDIFNFDYIEISEFLQETQSYC
151 RQLVTRGRKHIKTEPKMLSTLPTSRQLVLLDAFKDAVHSQNIRQLKELLS
201 EDIQFAADGGGKVSAIRHPFIGQSNVLRFFERLLFIAWNELSWKICLLNG
251 NLGFKLYDHNQTYVTAITFNFNQSQISDIYVLRNPEKLK

>ECFp138166 ECF41 ECF41s40 Acinetobacter sp. COS3

1 MNTTTNFSNEDLKLFQASRTFLFGLAYRLLGSVHETEDVLQEIFIKWQQQ
51 PKQDIINPQAWLTSVCTRHCIDLLRSHHKSRTEYIGTWLPEPYDQSEDLS
101 IESDYTLSTAFLLVLEKLSAKERAAYLLHDIFNFDYIEISEFLQETQSYC
151 RQLVTRGRKHIKSESKVLSTIPSSRQLVLLHAFKDAVHSQNIGRLKELLS
201 EDIQIAADGGGKVSAIRHPFIGQSDVLRFFERLLFIAWNELSWEICLLNG
251 NHGFKLYDNNHSYVTAITFSFNQSQISDIYVLRNPEKLK

>ECFp19182 ECF41 ECF41s40 Acinetobacter sp. ANC 3880

1 MKASGMISQQDLTIFETSRTFLFGLAYRLLGTTSDAEDVLQDIFIKWQQQ
51 PKQDILNPQAWLTSVCTRHCIDLLRAHHRSRTEYTGTWLPEPYHHTETFS
101 VESDYTLSTAFLLILEKLSVKERAAYLLHDIFNLDYVEISEILREQQSNC
151 RQLVARSRKRIADEPNVLSNHPTQQQINLLNAFKVAIHSHDLNQLTQLLS
201 DDIQFAADGGGKVSAIRQPFIGQPPILRFFERLLFQAWTELSWDMCHING
251 GVGFKLYDSDHCCVMVLTFAFNDQQQLQSIYSLRNPDKLK

Name Aliases LCA Taxa Group Subgroup
ECFp16008
  • RNA polymerase subunit sigma-24
  • hypothetical protein
  • ... more
Acinetobacter ECF41 ECF41s40

>ECFp16008 ECF41 ECF41s40 Acinetobacter

1 MKASGMISQHDLTIFETSRTFLFGLAYRLLGTTSDAEDVLQDIFIKWQQQ
51 PKQDILNPQAWLTSVCTRHCIDLLRAHHRSRTEYTGTWLPEPYHHTETFS
101 VESDYTLSTAFLLILEKLSVKERAAYLLHDIFNLDYVEISEILREQQSNC
151 RQLVARSRKRIADEPNILSNHPTQQQINLLNAFKVAIHSHDLNQLTQLLS
201 DDIQFAADGGGKVSAIRQPFIGQPPILRFFERLLFQAWTELSWDMCHING
251 GVGFKLYDSDHCCVMVLTFAFNDQQQLQSIYSLRNPDKLK

>ECFp13424 ECF41 ECF41s40 Acinetobacter sp. CIP-A165

1 MMQNQQNLTKHDLDLFQASRAFLFGLAYRLLGSTHDADDVLQDIFLKWQM
51 QPKEEILNPQAWLTSVCTRHCIDLLRSHHKSRTEYVGTWLPEPYQHTEQM
101 SIESDYTLSTAFLLVLEKLSPKERAAYLLHDIFNLDYQEVSEILQEQHSY
151 CRQLVVRGRKRISEQPKALSTLPTSHQMALLNAFRYAIHSHNLDQLKKLL
201 SEDIQLAADGGGKVSAIPQPLIDQPSVLRFFERLLFQAWNELFWEICHLN
251 GNIGFKLYDQQHNCVIAMTFAFDCNQQIQNIYVMRNPDKLKNKRPT

>ECFp10925 ECF41 ECF41s40 Acinetobacter

1 MNRPTSISQDDLNLFQASRTFLFGLAYRLLGSTSDAEDALQDVFIKWQQQ
51 PKHEIIHPQAWLTTICTRHCIDLLRSHHKSRTDYIGTWLPEPYHHTEELF
101 VESDYTLSTAFLLILEKLSVKERAAYILHEIFNLDYAEIADILLEQQNYC
151 RQLVTRSKKRIAEQPKVLSTIPTSHQITLLNAFKDAIHSHNLEQLKALLS
201 EDILFAADGGGKVSAIRQPFTDLNSVLRFFERLLFQAWTELSWEMCYLNG
251 NIGFKLFDQQHHCVIVLTFHFDQQHISDIYVLRNPEKL

>ECFp173177 ECF41 ECF41s40 Acinetobacter haemolyticus

1 MNRPTNISQDDLNLFQASRTFLFGLAYRLLGSTSDAEDALQDVFIKWQQQ
51 PKHEIIHPQAWLTTICTRHCIDLLRSHHKSRTDYIGTWLPEPYHHTEELL
101 VESDYTLSTAFLLILEKLSVKERAAYILHEIFNLDYAEIADILLEQQNYC
151 RQLVTRSKKRIAEQPKVLSTIPTSHQITLLNAFKDAIHSHNLEQLKALLS
201 EDILFAADGGGKVSAIRQPFTDLNSVLRFFERLLFQAWTELSWEMCYLNG
251 NIGFKLYDQQHHCVIVLTFHFDQQHISDIYVLRNPEKL

>ECFp17892 ECF41 ECF41s40 Acinetobacter sp. CIP 110321

1 MKASGMISQHDLTIFETSRTFLFGLAYRLLGTTSDAEDVLQDIFIKWQQQ
51 PKQDILNPQAWLTSVCTRHCIDLLRAHHRSRTEYTGTWLPEPYHHTETFS
101 VESDYTLSTAFLLVLEKLSVKERAAYLLHDIFNLDYVEISEILREQQSNC
151 RQLVARSRKRIADEPNVLANHPTQQQINLLNAFKIAIHSHDLNQLTQLLS
201 DDIQFAADGGGKVSAIRQPFIGQPPILRFFERLLFQAWIELSWEMCHING
251 SVGFKLYDSDHCCVMVLTFAFNDQQQLQSIYSLRNPDKLK

>ECFp16317 ECF41 ECF41s40 Acinetobacter venetianus VE-C3

1 MNTTTNFSNEDLKLFQASRTFLFGLAYRLLGSVHETEDVLQEIFIKWQQQ
51 PKQDIINPQAWLTSVCTRHCIDLLRSHHKSRTEYIGTWLPEPYDQSEDLS
101 IESDYTLSTAFLLVLEKLSAKERAAYLLHDIFNFDYIEISEFLQETQSYC
151 RQLVTRGRKHIKSESKVLSTIPSSRQLVLLHAFKDAVHSQNIGRLKELLS
201 EDIQIAADGGGKVSAIRHPFIGQSDVLRFFERLLFIAWNELSWEICLLNS
251 NFGFKLYDHNHTYVTAITFSFNQSQISDIYVLRNPEKLK

>ECFp13365 ECF41 ECF41s40 Acinetobacter sp. CIP 56.2

1 MKASGMISQHDLTIFETSRTFLFGLAYRLLGTTSDAEDVLQDIFIKWQQQ
51 PKQDILNPQAWLTSVCTRHCIDLLRAHHRSRTEYTGTWLPEPYHHTETFS
101 VESDYTLSTAFLLVLEKLSVKERAAYLLHDIFNLDYVEISEILREQQSNC
151 RQLVARSRKRIADEPNVLANHPTQQQINLLNAFKIAIHSHDLNQLTQLLS
201 DDIQFAADGGGKVSAIRQPFIGQPPILRFFERLLFQAWTELSWEMCHING
251 SVGFKLYDSDHCCVMVLTFAFNDQQQLQSIYSLRNPDKLK

>ECFp15463 ECF41 ECF41s40 Acinetobacter

1 MKASGMISQQDLTIFETSRTFLFGLAYRLLGTTSDAEDVLQDIFIKWQQQ
51 PKQDILNPQAWLTSVCTRHCIDLLRAHHRSRTEYTGTWLPEPYHHTETFS
101 VESDYTLSTAFLLILEKLSVKERAAYLLHDIFNLDYVEISEILREQQSNC
151 RQLVARSRKRIADEPNVLSNHPTQQQINLLNAFKVAIHSHDLNQLTQLLS
201 DEIQFAADGGGKVSAIRQPFIGQPPILRFFERLLFQAWTELSWEMCHING
251 SVGFKLYDSDHCCVMVLTFAFNDQQQLQSIYSLRNPDKLK

>ECFp15201 ECF41 ECF41s40 Acinetobacter venetianus

1 MNTTTNFSNEDLKLFQASRTFLFGLAYRLLGSVHETEDVLQEIFIKWQQQ
51 PKQDIINPQAWLTSVCTRHCIDLLRSHHKSRTEYIGTWLPEPYDQSEDLS
101 IESDYTLSTAFLLVLEKLSAKERAAYLLHDIFNFDYIEISEFLQETQSYC
151 RQLVTRGRKHIKSESKILSTIPSSRQLILLHAFKDAVHSQNIGRLKELLN
201 EDIQFAADGGGKVSAIRHPFIGQSNVLRFFERLLFIAWNELSWKICLLNG
251 NLGFKLYDHNQTYVTAITFNFNQSQISDIYVLRNPEKLK

>ECFp15058 ECF41 ECF41s40 Acinetobacter sp. ANC 4105

1 MKASGMISQHDLTIFETSRTFLFGLAYRLLGTTSDAEDVLQDIFIKWQQQ
51 PKQDILNPQAWLTSVCTRHCIDLLRAHHRSRTEYTGTWLPEPYHHTETFS
101 VESDYTLSTAFLLILEKLSVKERAAYLLHDIFNLDYVEISEILREQQSNC
151 RQLVARSRKRIADEPNVLLNHPSQQQINLLNAFKVAIHSHDLNQLTQLLS
201 DDIQFAADGGGKVSAIRQPFIGQPPILRFFERLLFQAWTELSWEMCHING
251 SVGFKLYDSDHYCVMVLTFAFNDQQQLQSIYSLRNPDKLK

>ECFp14422 ECF41 ECF41s40 Acinetobacter venetianus

1 MNTITNFSNEDLKLFQASRTFLFGLAYRLLGSVHETEDVLQEIFIKWQQQ
51 PKQDIINPQAWLTAICTRHCIDLLRSHHKSRTEYIGTWLPEPYDQSEDLL
101 IESDYTLSTAFLLVLEKLSAKERAAYLLHDIFNFDYIEISEFLQETQSYC
151 RQLVTRGRKHIKAEPKMLSTLPTSRQLVLLDAFKDAVHSQNIGRLKELLS
201 EDIHFAADGGGKVSAIRHPFIGQSNVLRFFERLLFIAWNELSWKICLLNG
251 NLGFKLYDHNQTYVTAITFNFNQSQISDIYVLRNPEKLK

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more