ECF proteins of ECF subgroup ECF41s26

Displaying ECF 1 - 20 of 60 in total

>ECFp172477 ECF41 ECF41s26 Saccharopolyspora shandongensis

1 MGGGHGERLGAEWQEHRPAVFGVAYRLLGSVADAEDVVQDVWLRAAAADL
51 GDVDDLRAWLVTVAARRSYDILKSARVQRESYFGPWLPEPLLTGPDAAEP
101 VLVDESVGSAMLLIMEELSPPERVALVLHDVFGLEFARIAEVLGGSVPAA
151 RKLASRARHRVAEARGSAPDVPRAELDRLVFAFRAAYETGDLAALVELMH
201 PDAVYLTDGGGQVSAARVPIVGGQRIAEVLLRVGRRWRADRIDIVEIGGE
251 PALVLHREGGIHSVDTFGFADGRIVAYRRVLNPRKLAHLKAVTSE

>ECFp14790 ECF41 ECF41s26 Streptomyces flocculus

1 MPGEEWEQHRPAVFGVAYRLLGSVADAEDVTQDVWLRTARVRPDGIADPR
51 AWLVTVAARRAYDVLRSARVRREEYVGPWLPEPLLTGPDAAEPVLADDSV
101 GTAMLLVMEELNPAERVAFVLRDVFRLSAADIGRVLDRSPAAVRQLTSRA
151 RRRIADARDRAPGEDGGTGAAAAGAGGGPSARAERERLLLAFRAACLAGD
201 LEGLVKLLDPDAVYVVDGGGEVFAARKPITGGRRIAEVLLRVARRWRLDG
251 LRPVEVGGEPALLCLRAGALHSVDTVLLRNGRIAAYWRQATPSKLSHVPA
301 HI

Name Aliases LCA Taxa Group Subgroup
ECFp19920
  • RNA polymerase subunit sigma-24
  • ADL00_02160
  • ... more
Streptomyces sp. AS58 ECF41 ECF41s26

>ECFp19920 ECF41 ECF41s26 Streptomyces sp. AS58

1 MGDGHTPGRSRQEDTLENEWETHRPAVFGVAYRLLGTLADAEDVTQDVWL
51 RAAGADLSKVTDLRAWLVTVAARRSYDILRSARLRRETYVGPWLPEPLLT
101 GPDASEPVLVDESVSSAMLLIMEELSPPERVAFVLHDVFGLQFARIAEVL
151 DVAVPSARQLASRARRRVAKAKESAPQAPKAERDRVLATFRAAYESGDLA
201 GLVRLLHPDAVYVTDGGGKIAAARKAIHGGERIAEVMVRVGRQQRPDAID
251 LIEVGGELALVFRRDGGVYSIDTLQVTDGLITAYRRVLNPEKLAHV

Name Aliases LCA Taxa Group Subgroup
ECFp19811
  • hypothetical protein
  • F603_RS0113435
Streptomyces sulphureus DSM 40104 ECF41 ECF41s26

>ECFp19811 ECF41 ECF41s26 Streptomyces sulphureus DSM 40104

1 MSSEQKAVAAVAGGMSGEEWEDHRPAVFGVAYRLLGSVADAEDVVQDVWL
51 RTTGGRLEGVDNRRAWLVTVAARCAYDLLKSARVRREEYVGPWLPEPLMT
101 GPDAAQPVLVDESVGSAMMLVMEELNPPERVAFVLRDVFGLDMTRIAGVL
151 DRSPTAARQLASRARRRITKARDVGEAGIVAPRAEREQVLRTFRAAYECG
201 DLEGLVRLLDPEAVYVTDGGGEVFAARKPIVGGRRLAEVLLRMGRRWRLD
251 NVELVEVGGEAALLCRREDGSVHSVDTVRLRGGRIVAYWRQLTPSKLAHL

Name Aliases LCA Taxa Group Subgroup
ECFp1974
  • RNA polymerase subunit sigma-24
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Thermomonospora curvata DSM 43183 ECF41 ECF41s26

>ECFp1974 ECF41 ECF41s26 Thermomonospora curvata DSM 43183

1 MSDRLAEEWRRHRPAVFGVAYRILGSVADAEDVTQDVWLRAAGARLEEVR
51 DLRAWLVTVAARRSYDLLTSARARHEDYIGPWLPEPLLTGPDAAEPVLVD
101 DLVGTAMLLVLRELSPPERIAFVLRQAFDVPYDRIGRVLDRSPAACRQLV
151 SRARRRIAARMRGNGPRASRAERERVMAAFRAAHEKGDTAALASLLDPEA
201 VYITDGGGEVFAARKPIVGNVRIAETLLRVARRPVPAAFVPAEVNGEPGL
251 LVYRDGRLVAVDTAEIAAGRIVAYRRVLNPRKLRGIRPRGA

Name Aliases LCA Taxa Group Subgroup
ECFp19011
  • RNA polymerase subunit sigma-24
  • IH48_RS0129670
Streptomyces sp. NRRL F-5126 ECF41 ECF41s26

>ECFp19011 ECF41 ECF41s26 Streptomyces sp. NRRL F-5126

1 MCTGDGHGPRRSEREDPLEAGWERHRPAVFGAAYRLLGSVADAEDVTQDV
51 WLRAAGADLRGIDDLRAWLVTVAARRSYDILKSARFRRETYVGPWLPEPL
101 LTGPDASQPVLVDESVGSAMLLIMEELSPPERVALVLHDVFGLAFGRIAE
151 VLDVSVPGARQLASRARRRVAKAKQSMPQASKAERERVLAVFRAAYEAGD
201 LAGLVRLLHPDAVYVTDGGDKAAAARKPIHGGERVAEVMVRVGRQWRPDR
251 IDLVEVGGELSLAFRREGRVYSVDTLQIADGLITAYRRVINPDKLSHL

Name Aliases LCA Taxa Group Subgroup
ECFp18893
  • RNA polymerase subunit sigma-24
  • SIRAN_RS38050
Streptomyces iranensis ECF41 ECF41s26

>ECFp18893 ECF41 ECF41s26 Streptomyces iranensis

1 MGDGHAPGPSGREDVLGADWESHRPAVFGVAYRLLGSVADAEDVTQDVWL
51 RAAGADMRDVGDPRAWLVTVAARRSYDVLKSARFRRETYVGPWLPEPLLT
101 GPDASEQVLVDESVGSAMLLIMEELSPPERVAFVLHDVFGLEFGRIAEVL
151 DVSVPGARQLASRARRRVAKARQSMPQAPKAERERVLAVFRAAYEAGDLA
201 GLVRLLHPDAVYVTDGGGKAAAARKPIHGGERVAEVMVRVGSQWRPDCID
251 LVEVGGELALVFRREGRVYSVDTLQITDGLITAYRRVINPDKLSHV

>ECFp17911 ECF41 ECF41s26 Streptomyces monomycini

1 MGDGHGPGRSEQEDLLGAGWESHRPAVFGAAYRLLGSVADAEDVTQDVWL
51 RAAAADLRDVADLRAWLVTVAARRSYDILKSARFRRESYVGPWLPEPLLT
101 GPDASQPVLVDESVSSAMLLIMEELSPPERVAFVLHDVFDVAFGEIADVL
151 NVSAPSARQLASRARRRVAKAKQSMPQASKAERERVLAVFRAAYEAGDLA
201 GLVRLLHPDAVFVADGGGKVSAARKLIHGGERVAETIVRVGRRWHLDRVD
251 FAEVGGELALVFYREGRVHSVDTVQITDGLITAYRRVVNPDKLLRV

>ECFp17703 ECF41 ECF41s26 Promicromonospora kroppenstedtii DSM 19349

1 MPGQERLRQEWAEHRPAVFGAAYRLLGSVADAEDVTQDVWLRALGADLDE
51 VRNLRAWLITVAARRSYDILNSARRRRESYVGPWLPEPLLTGPDAAEPVL
101 VDESVTAAMLLVMERLSPPERVAFVLHDVFELEFARIAEILDVTVPGARK
151 LASRARQRVAAQQDAEPRTSRVSRAERERVLEAFRGAYETGDLEGLVGLL
201 DPDVVYVTDGGGKVHAARKPIVGGRRVAEVMVRVGHQLPPDRIDLVEVGG
251 ELSLVFHREGKVFSVDTVQIADGRITAYRRVVNPDKLTHV

Name Aliases LCA Taxa Group Subgroup
ECFp17595
  • RNA polymerase subunit sigma-24
  • H299_RS0116450
Streptomyces sp. CNH287 ECF41 ECF41s26

>ECFp17595 ECF41 ECF41s26 Streptomyces sp. CNH287

1 MRGMPGDEWQEHRPAVFGVAYRLLGSVADAEDVVQDVWLRTTRTPPAEIA
51 DRRAWLVTVAARRAYDILRSARVRREEYVGPWLPEPLLTGPDAAQPVLVD
101 ESVGAAMMLVMERLNPPERVAFVLRDVFALETPRIAGVLDRTPAATRQLL
151 SRARRKVASARAAGEAGTGAPRAERERVLLAFRTAYEAGDLEVLVRLLDP
201 DAVYLTDGGGEVFAARKPIVGGRRVAEVLLRVGRDRLRLRAAVVEVGGEP
251 ALLCRREGAVHCVDTVVLRGGRIAAYRRQMTPSKLAHL

>ECFp173354 ECF41 ECF41s26 Mycobacterium sp. SWH-M3

1 MPDQQDTLGAEWESHRPAVFGVAYRLLGTVADAEDVAQDVWLRAAAADLE
51 QIEDLRAWLVTVAARRSYDILKSARLRRESYVGPWLPEPLLTGPDASESV
101 LVDESVSTAMLLVMEELSPPERVAFVLHDVFGIEFGRIADVLDVSAPAAR
151 QLASRARRRVAKAKESAPRASKAERERVLVAFRAAYESGDMAGLVALLHP
201 GAVYVTDGGGEVFAARKLIHGGERVAEVMVRVSRQWRADRIDFVEVGGEL
251 ALVFHREGGVYSVDTVQITDGLISAYRRVINPDKLSHV

>ECFp17327 ECF41 ECF41s26 Streptomyces sp. NRRL F-6602

1 MTTAPGAPEAGAGVPGEEWEQHRPAVFGVAYRLLGSVADAEDVTQDVWLR
51 TARVRPDGIADPRAWLVTVAARRAYDVLRSARVRREEYVGPWLPEPLLTG
101 PDAAEPVLADESVGTAMLLVMEELNPAERVAFVLRDVFRLSAADIGRVLD
151 RSPAAVRQLTSRARRRIADARDRAPGEDGGTGAAAAGAGGGPSARAERER
201 LLLAFRAACLAGDLEGLVKLLDPDAVYVVDGGGEVFAARKPITGGRRIAE
251 VLLRVARRWRLDGLRPVEVGGEPALLCLRAGAPHSVDTVLLRNGRITAYW
301 RQATPSKLSHVPAHI

>ECFp173189 ECF41 ECF41s26 Mycolicibacterium fortuitum

1 MADQQDLLLSEWEVHRPAVFGVAYRLLGTVADAEDVAQDVWLRASGADLE
51 KVDDLRAWLVTVAARRSYDLLKSARARREEYVGPWLPEPLLTGPDAAEPV
101 LVDESVSSAMMLIMDELKPPERVAFVLHDVFGIEFARIAEVLDVTAPGAR
151 QLASRARARVAKAKESTPQASKADRERVLTTFRAAYESGDVAGLVALLHP
201 DVVYVTDGGGKVSAARKPIYGGQRVAEVMVRVGRQWRPDHIGFIEVGGEL
251 ALLFHRQGGVYSVDTLQITDGLIAAYRRVINPDKLSRL

Name Aliases LCA Taxa Group Subgroup
ECFp173004
Microbispora rosea ECF41 ECF41s26

>ECFp173004 ECF41 ECF41s26 Microbispora rosea

1 MRKLGEVAICMGDGHGPGRSEQEDPLGAEWERHRPAVFGVAYRLLGSVAD
51 AEDVTQDVWLRATGADLRDIGDLQAWLVTVAARRSYDILKSARFRRETYV
101 GPWLPEPLLTGPDASQPVLVDESISSAMLLIMEELSPPERVAFVLHDVFG
151 LEFARIAEVLDVSGPGARQLASRARRRVAKAKQSTPQASEAERERVLTVF
201 RAAYEAGDLAGLVRLLHPDAVYVTDGGGKVSAARKLIHGGERIAEVMVRV
251 GRQWHLDRIDVVEVGGELALVFHREGRVYSVDTVQIADGLITAYRRVINP
301 DKLVRV

>ECFp172903 ECF41 ECF41s26 Streptomyces cinnamoneus

1 MGDGHGAGRFEREDSLGAGWERHRPAVFGVAYRLLGSVADAEDVTQDVWL
51 RAAGADLRDIGDLRAWLVTVAARRSYDILKSARFRRESYVGPWLPEPLLT
101 GPDASQPVLVDESVSSAMLLIMEELSPPERVAFVLHDVFGLEFGKIAEVL
151 DVSVPGARQLASRARRRVAKAKQSMPQASKAERERVLAVFRAAYEAGDLA
201 GLVRLLHPDAVFVTDGGGKAFAARKLIHGGERVAEVMVRVGRRWRPDRIA
251 FAEVGGELALVLYREGRVHSVDTVQITDGLITAYRRVINPDKLVRV

>ECFp172805 ECF41 ECF41s26 Nonomuraea jiangxiensis

1 MVGFDRSARLDEEWELHRPAVFGAAYRLLGSVAEAEDVLQDVWLRAASAD
51 LSEVVDLRAWLVTVAARISYNVINSARVRKVGYIGPWLPEPLMTGPDVAQ
101 RVLVDDSVSTAMLLVMRELPPPERVAFVLHDVFELPFEQIAGALGRSPVA
151 CRKLASRARRRVAGARVPPRASRAERERVLYAFRAASQAGDLAGLVSLLD
201 PDVVYVADGGGKATAARVPVHGVERVARLLLWFGTHRPGDRVEVVEVNGD
251 PGLATHREGRLCWIDTVEVRDGRIAAYLRVANPDKLPGHL

>ECFp172464 ECF41 ECF41s26 Actinopolymorpha singaporensis

1 MDDGRVPGRCEQEDTLAAEWERHRPAVFGVAYRLLGGVADAEDVTQDVWL
51 RAAGTDLQDVDDLRAWLVTVAARRSYDILKSARFRRETYVGPWLPEPLLT
101 GPDASEPVLVDEAVGTAMLLIMEELSPPERVAFVLHDVFGLEFDRIAGVL
151 DVSVPGARQLASRARRRVAKAKQSSPQASKAERERVLAAFRAAYEVGDLA
201 GLVRLLHPDVVYVTDGGGEALAARKLIHGGERVAEVMVRVGRQWRPDRID
251 LVEVGGELALVFRREGRVYSVDTLEIADGLITTYRRVINPDKLSHV

>ECFp172400 ECF41 ECF41s26 Streptomyces sp. 136MFCol5.1

1 MDVTRMPRPPGVLENEWGALRPAVFGAAYRLLGSVADAEDVTQDVWLRAA
51 TADLRDVRDLRAWLLTVAARRSYDILKSARARRETYVGPWLPAPLLTGPD
101 ASEPVLVDESVGSAMLLVMEELKPPERVAFILHDVFGLEFSQIADVLGAS
151 GAAARQLASRARRKMATAKQSTPHASRAERERLLTTFRDAYEAGDIAGLV
201 RLLHPDAVYVTDGGGKLAAARKYIHGGARIAMVMVRVGRQWRPDSIEVIE
251 VGGEPALLLRREGRAVSVDTVEIKDGLVVAYRRVLNPDKLAHL

>ECFp172294 ECF41 ECF41s26 Micromonospora avicenniae

1 MGDWRGPGRPEREDPLGAGWERHRPTVFGVAYRLLGSVADAEDVAQDVWL
51 RAAGADLREVDDLQAWLVTVAARRSYDILKSARVRRETYVGPWLPEPLLT
101 GPDASQPVLVDESVSSAMLLIMEELSPPERVAFVLHDVFGLEFGRIAEVL
151 DVSVPGARQLASRARRRVANAKQSTPHASKAERERVLTAFRAAYEAGDLA
201 GLVRLLHPGAVYVTDGGGKVSAARKPIHGGERVAEVMVRTGLQWHPDRID
251 FAEVGGELGLVFHRDGRVYSVDTVQITDGLISAYRRVINPDKLARL

>ECFp171855 ECF41 ECF41s26 Actinomadura sp. CNU-125

1 MPRPEAGRLDDEWALHRPAVFGAAYRITGSVADADDIVQDTWLRAADASL
51 DDVRDLRAWLITVAARRAYDVLRSARARRVDYVGPWLPEPLLTGPDAAEP
101 VLVDDTLGTAMLLVMEELSPPERVAFVLYRAFGVPYERIAEVLGKTPAAC
151 RQLVSRAGRKVAAAPPPSGGPEGARVLAAFRAAYERRDEAALLELLDPDA
201 AYTTDGGGRVFAARKVVRGAARIATALLRTSVNYGFRSTPAEVNGGPGML
251 VHRDGRLVAIDALEIADGRVVAYRRVLNPAKLDGGGRADAR

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more