ECF proteins of ECF subgroup ECF41s20

Displaying ECF 1 - 20 of 84 in total

>ECFp172599 ECF41 ECF41s20 Tersicoccus sp. Bi-70

1 MDATSEFEHERPRLLRVAARVLGDPVEAEDVVQQAWLRMHTADGPVENLP
51 AWLTTVTTRLCLDRLKARVAVPVDTTAPSDSLEETAVVPDPADAAVLTDA
101 VGGALGVVLDRLSPAERVAFVLHDSFAVDFPAIAGILDTSPVAARKLASR
151 ARAKVAQPSSSAREDHRPAAWEVVDAFMAAAREGELGRLVALLAPDARIT
201 ADEAAVLAGTPERIEGRDAVAAFFNGSAQAALPVFVGDGPGSAWYHRGRA
251 AVFFDFTVLDGQVREITFRADAAVLARVRRRRGADFA

>ECFp14652 ECF41 ECF41s20 Mycobacterium sp. 1423905.2

1 MSEDRLHDGFEAERPRLQRIAARVLGDADAAQDVVQQAWLRLHATEEPIA
51 NLPGWLTTVTSRLCLDQLRARTPVPTESIEVEGTALDPADDVVLADTVGV
101 ALQVVLDRLTPAERVAFVLHDSFGIDFESIASMLDTTSAAVRKMASRARA
151 KVRPAAPEDALADWEVVDAFMAAAREGNFTRLLELLAPDVVVSADAAASA
201 LGTPTRLEGAHEVASFFNGAAKAAFPVFVEDRPGAAWIHRGEAKVAFDFI
251 VENGRINRLQFRASEDVLAGIRRREGANARE

Name Aliases LCA Taxa Group Subgroup
ECFp11709
  • RNA polymerase subunit sigma-70
  • ASG76_11950
  • ... more
Nocardioides sp. Soil774 ECF41 ECF41s20

>ECFp11709 ECF41 ECF41s20 Nocardioides sp. Soil774

1 MERVDQTEIFEAERPRLLGIASRVLGDHAEAQDVVQQAWLRLDRATTGDT
51 TVIDNLPAWLTTVTTRLCLDRLRARTPMPYEDVELVGDDATAPDPADDVA
101 LADTVGIALQAVIDRLSPRERVAFVLHDSFGFEFTTIAAVLDSTPAAARK
151 LASRARAKVAQPAADDALADWEVVDAFMSAARGGDLVRLLQLLAPDAVVG
201 ADEAAVLAGTPASIEGREEVAAFFDGSAQSALAVYVGDRPGSAWFLRGEA
251 KVVFDFTVEGGLVRGITFRADPDVLARVVRRSGPARG

>ECFp19857 ECF41 ECF41s20 Mycobacterium sp. E3078

1 MVNDDQLRDGFEAERPRLQRIAARILGDADGAQDVVQQAWLRLHATEEPI
51 DNLPGWLTTVTSRLCLDRLRARTPVPTESIQVEATEPDPADDVVLADTVG
101 IALQVVLDRLTPAERVAFVLHDSFGVDFELIASMLDTTPVAARKLASRAR
151 AKVRPPTPEDALADWEVVDAFMAAAREGDFTRLLELLAPDVVVSADAAAA
201 ALGTPTRLQGPDEVAGFFNGAAKAAFPVFVEDRPGAAWIHRGEVKVAFDF
251 IIEAGQVRRLQFRAAEDVLAGVRRREGASTRE

>ECFp19763 ECF41 ECF41s20 Cryobacterium sp. MLB-32

1 MDETAAFERERPRLLRIAGRILRDNAEAEDMVQQAWLRLHSTEAVIDNLP
51 GWLTTVTTRLCLDRLRAPKPILVDDTAFPSPTEDPADALALADTVGIALQ
101 VVLDRLTPNERVAFVLHDSFSIDFPTIAMILGSTPAAARKLASRARSKVR
151 PQGTLRRRADWEVVDAFLAAAREGDFEQLLALLAPGVVVAGDEAAISAGT
201 PTRIEGRNAVATMFNGAAKAALPVFVDGRPGAAWFHLGSPQVAFDFTVVD
251 GVVSRIDFRADPAIVEHLIRRKEGERRN

Name Aliases LCA Taxa Group Subgroup
ECFp19588
  • RNA polymerase subunit sigma-70
  • ASF46_12695
  • ... more
Rathayibacter sp. Leaf296 ECF41 ECF41s20

>ECFp19588 ECF41 ECF41s20 Rathayibacter sp. Leaf296

1 MEWTAVFEAERGRLTGLATRLLDDRHEAEDIVQLAWLRLHGSDAVLENPA
51 AWLTTVTTRLCLDRLRARIPEPVEAVADPPASSADPAESAERRDEVGRAL
101 QVVVDRLSPNERVALVLHESFGYSFDTIGGILDRSPAAARKLASRAREKV
151 ASAEQDGPASDRSVVDAFMAAARGGDLAGLLALLAPGATVRADAAAITAG
201 TPERIDGREAIAAFFDGSAHAALPVLTAGRPGFAWFHLGEARVLFDFAVR
251 DGRVESIVFRAAPEALAGVVRRPRDTPAVTSEGPRPS

>ECFp19536 ECF41 ECF41s20 Serinicoccus chungangensis

1 MDRTSAFEAERPRLTRIATQVLRDPAEAQDVVQTAWLRLHTHGAAGIENL
51 PGWLTTVTVRLCLDRLRARVPEPVDHREAAPRSGPDAVEDPAEEVVLADT
101 VGVALQVMLDRFTPSERVAFVLHDTFEVDFPTIAQILGRSPAATRKLASR
151 ARAKVRQPVAPQRRADAVVVDAFLAAARQGDVTRLLELLAPDALVQGDAA
201 AVEVGTPARIEGREAVARMFDGGAAAALSVLVDDRPGAAWFLRGMPQVAF
251 DFTVQDGLVRRIDLRADPGVLASLRRRTTAS

Name Aliases LCA Taxa Group Subgroup
ECFp19426
Kocuria sp. SM24M-10 ECF41 ECF41s20

>ECFp19426 ECF41 ECF41s20 Kocuria sp. SM24M-10

1 MERTKIFEAERPRLLRLAAGVLADHAEAEDVVQQAWLRLHRTEAEIENPP
51 AWLTTVTTRLCLDRLKARTPVPAPEIGPPDTAPDPADEVVLADAVGVALQ
101 LVLDRLSPQQRVAFVLHESFGVEFSTIAAVLDTTPAAARKLASRARAEVG
151 RSAPEGRAADGEVVDAFMAAARQGDLQRLVRLLAPGVTVTADDAAILAGT
201 PQRIDGREEVAAFFDGSAHAALPVFVGSRPAAAWFHRGRARVLFDITVVD
251 GLVAHITFRAAPEVLAQVVRRDGQRPRA

Name Aliases LCA Taxa Group Subgroup
ECFp19375
Mycobacterium szulgai ECF41 ECF41s20

>ECFp19375 ECF41 ECF41s20 Mycobacterium szulgai

1 MTSDDHLHDGFETERPRLQRIAARVLGDADAAQDVVQQAWLRLHATEEPI
51 GNLPGWLTTVTSRLCLDHLRARTPVPTESIEVEATAPDPADDVVLADTVG
101 VALQVVLDRLTPAERVAFVLHDSFGIDFDSIASMLDTTSVAVRKMASRAR
151 AKVRPAATEDALADWEVVDAFMAAAREGDFTRLLELLAPDVVVLADAAAS
201 ALGTPVRLEGPDEVAGFFNGAAKAAFPVFVQDRPGYAWIHRGEAKVAFDF
251 TVENGRIHRLQFRAAGDVLAGLRRREGANARN

>ECFp19373 ECF41 ECF41s20 Mycobacterium sp. E2660

1 MVNDDQLRDGFEAERPRLQRIAARILGDADGAQDVVQQAWLRLHATEEPI
51 DNLPGWLTTVTSRLCLDRLRARTPVPTESIQVEATEPDPADDVVLADTVG
101 IALQVVLDRLTPAERVAFVLHDSFGVDFELIASMLDTTPVAARKLASRAR
151 AKVRPPTPEDALADWEVVDAFMAAAREGDFTRLLELLAPDVVVTADAAAS
201 ALGTPTRLQGPDEVAGFFNGAAKAAFPVFVEDRPGAAWIHRGEVKVAFDF
251 TIEAGRVRRLQFRAAEDVLAGVRRREGASTRE

Name Aliases LCA Taxa Group Subgroup
ECFp19332
  • RNA polymerase subunit sigma-70
  • HGAM_RS07540
Aeromicrobium massiliense JC14 ECF41 ECF41s20

>ECFp19332 ECF41 ECF41s20 Aeromicrobium massiliense JC14

1 MLDDRVEAEDVVQQAWLRLHGTDRRIDSLPAWLTTVTTRLCLDRLRAKVP
51 VPEEPVDAADPYDDPVEDAVLADSVGEALSVVLDRLSPNERVAFVLHDSF
101 GHDFAAVAAVLDTSPAAARKLASRARAKLAGPAPAAVPPRWEVVDAFLSA
151 AKGGHLDRLVALLAPDVVVGADAAAAALGTPTSIVGREQVSAFFDGSAHA
201 ALPVFAGDRAAAAWMDRGRARVVFDFDISDGVVTRIEFRAEPSLLATVRP
251 RRDGGPGGRDAPRAPA

Name Aliases LCA Taxa Group Subgroup
ECFp1926
  • Sigma-70 region 2
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Aeromicrobium marinum DSM 15272 ECF41 ECF41s20

>ECFp1926 ECF41 ECF41s20 Aeromicrobium marinum DSM 15272

1 MDRTAVFELERARLVTLASRVLSDSAEAEDVVQLAWLRLDSTQADILNLP
51 GWLTTVTTRLCLDRLRARVPVAVEEMPDEVHGPDPTERIELAESVGAALH
101 VVLDRLSPAERVALVLHDSFGVEFTTVAEILDVTPAAARQLASRARRKVG
151 GADEGHRRADARVVDAFMAAARNGEFERLLGVLAPQVEVGSDAAAILAGT
201 PERISGRQEVAEFFNGSAHAALPVTVGGRPGAAWFHRGEAKVLFDFTVQD
251 GLVGRIDFRADPDVLAGVVRRAPDPIDD

Name Aliases LCA Taxa Group Subgroup
ECFp19056
  • RNA polymerase ECF-type sigma factor
  • putative RNA polymerase ECF-type sigma factor
  • ... more
Gordonia aichiensis NBRC 108223 ECF41 ECF41s20

>ECFp19056 ECF41 ECF41s20 Gordonia aichiensis NBRC 108223

1 MDERDPDLTIEFERERSRLVRLAARVLGDDTEAHDLVQQAWLRMNSTDAV
51 IENLPAWLTTVTSRLCLDRLRARVPEAAEPTVDERSDDQDPADAVALADS
101 VGLALTMVLDRLSPAERVAFVMHDSFGFEFSTIASALDVTPTTARKLASR
151 ARAKVRQPAPDDALADWEVVDAFMAAARDGDFERLLELLAPNAEVRADDE
201 AIAAGTPVAIDGRRSIAEFFNGSASAALPVLVDERPAAAWFHRGAAAVVF
251 DFELVDGEVARITFRADPALLSRVNRRDRDTPRT

>ECFp18912 ECF41 ECF41s20 Tsukamurella tyrosinosolvens

1 MDADAELAAHFESSRTRLTALAARILLDRSAAEDVVQEAWVRLSRPGATE
51 LGTIVNLDGWMTTVVVRTSLNALRARSARPEDLVGGFGEDLAIRHEGSAS
101 PEDHAVIAEQVAFALELVLRTLTPPERVAFVLHDSFGVPFGDIAELLDRS
151 VDATRKLASRARSQVHALDASELETNPAARRSVVDAFFGAAARGDLAALV
201 EVLHPEVTFHADGGTSRPDMNANLQGRGAVSRRAAAFAVPDAQLEAVVIN
251 GCCGVVVRRNAVPLAAMAFTVLGGRIFQIYSLLDAVRVAELVATLPHDHR
301 S

Name Aliases LCA Taxa Group Subgroup
ECFp18651
  • DNA-directed RNA polymerase sigma-70 factor
  • H535_RS0117985
Arthrobacter castelli DSM 16402 ECF41 ECF41s20

>ECFp18651 ECF41 ECF41s20 Arthrobacter castelli DSM 16402

1 MDQTEIFEAERPRLLRIAGQVLDDHSEAEDIVQQAWLRLDRTDSSIESLP
51 AWLTTVTTRLCLDRLRARTPVPVDEIQPPEAAPDPADDVVLADTVGVALQ
101 YVLDRLSPAERVAFVLHDSFGFEFPTIASVLDITPAAARKLASRARAKVS
151 QPAAEGPLAEWEVVDAFMAAARNGEFERLLQLLAPDASVTADDAAILAGT
201 PQRIDGRQEVATFFNGSAKAALSVFVGERPAAAWFHRGEARVLFDFTVVD
251 GLVSGITFRAEPEVLEQVARRDGGQPRN

>ECFp18538 ECF41 ECF41s20 Janibacter limosus NBRC 16128

1 MDTTAQTEDFERERPRLVGLAARILGDHTEAEDIVQQAWLRLHGTDTDIE
51 SLPAWLTTVTTRLCLDRLKSRTPVPHSEVEPGEATPDIADDIVLADTVGV
101 ALQAVIERLTPGERVAFVLHDSFGFDFATIAAILDTTPAAARKLASRARG
151 KVRARSLRGSAADGLAPQGAGRSDWEVVDAFMAAARDGDFDSLLSLLAPD
201 AAITADTAAIATGTPERIDGRREIAEFFNGSAHAALAVLVDERPAAAWFL
251 KGEATVLFDFTLEDGLVCGITFRADPEVLARVTRRTDTHRG

>ECFp18376 ECF41 ECF41s20 Nocardioides sp. Root122

1 MDQTEIFEAERPRLVGIATRVLADHAEAEDVVQQAWLRLDRAVSRDDTEI
51 DSLPAWLTTVTTRLCLDRLRARTPVPVEDVELGDRPDLAGTAPDPAEDVA
101 LADTVGIALQAVIDRLSPRERVAFVLHDSFGFEFTTIAAVLDTTPAAARK
151 LASRARAKVAQPSSSDALADWEVVDAFMDAARGGDVERLLQLLAPDAVVG
201 ADEAAILIGTPASIQGRDEVASFFNGSAQTALAVFVGDRPASAWYLKGEA
251 KVVFDFDVADGQVRGITFRAAPDVLAEVVRRDGADPR

Name Aliases LCA Taxa Group Subgroup
ECFp18267
Kocuria turfanensis ECF41 ECF41s20

>ECFp18267 ECF41 ECF41s20 Kocuria turfanensis

1 MERTEIFEAERPRLLRLAVGVLADHAEAEDVVQQAWLRLHGTEAEIENPP
51 AWLTTVTTRLCLDRLKARTPVPAPGLGPPGTAPDPADEVVLADAVGVALQ
101 LVLDRLSPQQRVAFVLHESFGVEFATIATILGTTPVAARKLASRARARVG
151 GSAPEGRAADGAVVDAFMAAARQGDLQRLLRLLAPDVAVTADDAAILAGA
201 PQRIDGREEVAAFFDGSAHAALPVSVGGRPAAAWFHRGRARVLFDITVVD
251 GLVARITFRAAPEVLAQVVRRDGQGRRT

Name Aliases LCA Taxa Group Subgroup
ECFp17991
  • RNA polymerase sigma-70 factor
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Mycolicibacterium aromaticivorans JS19b1 = JCM 16368 ECF41 ECF41s20

>ECFp17991 ECF41 ECF41s20 Mycolicibacterium aromaticivorans JS19b1 = JCM 16368

1 MSHPVVRARQDVDATDDESVTAMVSDDQLHDGFEAERPRLQRIAGRILGD
51 ADAAQDVVQQAWLRLHATDEPIDNLAGWLTTVTSRLCLDRLRARTPVPTE
101 SIEVEETAPDPADDVVLADTVGIALQVVLDRLTPVERVSFVLHDSFGVDF
151 ELIASMLDTTPVAARKLASRARAKVRPASPEDALADWEVVDAFMTAAREG
201 DFTRLLQLLAPDVTVSADAAAAALGTPAHMEGRAEVARFFNGAAAAAFPV
251 FVEDRPGSAWIHRGEVKVAFDFVIEDGRVRRLQFRAEPDVLAGVRRREGA
301 ATRG

>ECFp17938 ECF41 ECF41s20 Janibacter corallicola NBRC 107790

1 MEDFERERPRLVALATRILGDHAEAEDVVQLAWLRLHGTDTDIESLPAWL
51 TTVTTRLCLDRLKSRTPVPHSEIEHPESSPDIAEEVILADTVGVALQAVI
101 DRLTPSERVAFVLHDSFGFEFATIAAILDTSPVAARKLASRARGKVRGLR
151 GSSVAPQPPGAPIVDAFMAAAREGDFDTLLSLLAPDAGITADAAAVAVGT
201 PERIDGRREVAEFFNGSARAALAVLVGPTAEDLDDRPGSAWFHRGEARVL
251 FDFTIEDGIVHGITFRADPQVLARVHRRPDTRR

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more