ECF proteins of ECF subgroup ECF41s2

Displaying ECF 161 - 180 of 1206 in total
Name Aliases LCA Taxa Group Subgroup
ECFp173531
Myxococcus fulvus ECF41 ECF41s2

>ECFp173531 ECF41 ECF41s2 Myxococcus fulvus

1 MDEEIRRAREFESHRTHLRAVAYRMLGSVSEAEDAVQEAWLHVRRADTHE
51 VVNPRGWLTTVVARVCLDFLRTRNSRREESEDLQGVSRLENVPAASDPEQ
101 ESLMADSVGVALLVVLDALSPPERIAFVLHDMFSLSFDDIGPIVGRTSTA
151 TRQLASRARRRVHGAALSPDADLSRQRELVAAFHAAARGGDLDALLAVLD
201 PDVVARTDARVLPAGATREVRGAASVARQATLASARARFTQLALIDGQVG
251 LVIAPGGRLVSVLRFTVEGGRVVAIESIFDPERLRRLEVTVFPG

>ECFp173538 ECF41 ECF41s2 Streptomyces sp. 2231.1

1 MDDFTGDAGQRLAERFEADRPHLAAVAYRLLGSATEADDALQEAWLRARQ
51 ADTGEVGNLTGWLTTVVTRVCLNLLRARRNRREDALDAHDSPAGAVTESG
101 DPAREALLADEVGIALLVVLDTLSPAERVAFVLHDMFAVPFEEIAPLIER
151 NPAATRQLASRARRRVRGREPVPTADAGRRRAAVEAFLAATRGGDFTALF
201 ALLAPDVALRADALVVPTPEPLTVQGAEPVARGAMAAMARARLTGVALLD
251 GRVGLVMAERGHPRLVLAFTFGTDGLITGIDITADPERLRGIDIGPADTD
301 R

>ECFp173550 ECF41 ECF41s2 Geodermatophilus africanus

1 MGGNDLLAARFEEHRDRLTAVAHRLLGSRAEAEDAVQEAWLRVSRAGTAG
51 VENLGGWLTTVVARVALNQLRARAGRREDPLDDAPQARLHAVADPAEEAV
101 LADSVGLALGVVLDRLAPAERLAFVLHDLFDVPFDEIAPIVDRSPAATRQ
151 LASRARRRVRAAGLPDATERRREVVAAFLDASRNGDFAALLALLHPEAVL
201 RSDPVATGMGSAAEVRGATAVARFLSGRARAARLVLVDGTPGAVWSLRGT
251 PQVVFAFTVADGAVTAIDLLADPPTLAGLELQPLPQR

>ECFp173539 ECF41 ECF41s2 Streptomyces sp. CB02923

1 MDEKEFLAERFEEHRAHLRAVAYRMLGSLSEADDAVQEAWLRLSRSDADG
51 IGNLGGWLTTVVGRVCLDLLRTRTARGEEPFDVRVPDPVIGSASGNGTGS
101 GTDGTDPEHQALLADAVGLALLVVLQTLAPAERLAFVLHDMFAVPFDEIG
151 PVVGRTPAATRQLASRARRRVRGTAAAPDADLARQREVVDAFLAASRGGD
201 FEGLLAVLDPDVVLRTDPGAAFPGLARTVRGAREVAGRALHFRHPAHDVR
251 HALVNGAAGIVAVADGVPVSVLGLTVAGGKIVAIDILADPERLRGLDLTA
301 IEE

>ECFp17362 ECF41 ECF41s2 Streptomyces atriruber

1 MNENGSAQVALAARFEEHRPRLNAVAYRMLGSLSESEDAVQEAWFRLSRT
51 EGGPAAGEVRNLGGWLTTVVGRICLDLLRSRQSRREDSLDASVRAFGETH
101 IPDPVVTRADTADPEAEVLLADSVGLALLVVLETLTPAERLAFVLHDMFA
151 VPFEEIAPVVERSAATTRQLASRARRRVQGSTPAAETDVAKQREVVEAWM
201 AATRAGDFDALLELLDPDVVLRADTGELSSGLSKVVRGAAEVAGQAAMFA
251 RVAADQHLVFLNGMPGLVALPGGEAVSLGSFTVVDGRIVEINIIADRERL
301 QVLTRPLREA

>ECFp17364 ECF41 ECF41s2 Streptomyces sp. RTd22

1 MDEQDRLAERFEAHRSHLRAVAYRLLGSLSEADDAVQETWLRLSRSDADR
51 VENLSAWLHTVVSRLCLDMLRSRSARREEPIERQPAHQVRDDGGGDPEGE
101 AVLIDSVGRALLVVLDTLAPAERIAFVLHDAFAVPFDQIAPVVERSPATA
151 KKLASRARHKVRGTPAASADGLAAQRRVVDAFLAAARDGDLEALLTVLAP
201 DVVRRADRAALPPGVPTTSRGARAVAEETRVLGRRARFAAPALVNGSVGV
251 VVAPHGRLLLALTFTVEDGRIAAYEVIADPVRLRGLELAVLDG

>ECFp17375 ECF41 ECF41s2 Streptomyces cellostaticus

1 MNSRDLLADRFEEHRGQLRAVAYRMLGSLAEAEDAVQEAWLRLGRTDADG
51 IRNLGGWLTTVVGRVCLDMLRSRSARREEPMDDTYVPDPLVRPLSRVDPE
101 TEVLEADSVGLALLVVLETLEPAERLAFVLHDMFAVPFDDIAAIVERTPA
151 ATRQLASRARRRVQGATPAADPDLGRQRQVVDAFLAASRGGDFEALLALL
201 HPDVELRADAGALVRGAAASKAVRGARAVAEQAAMFSRFAGFARLALVNG
251 AVGVVTAPEGQPLSVTAFTVADGRITGMYILADPGRLAGLDLPPLEA

Name Aliases LCA Taxa Group Subgroup
ECFp1738
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Conexibacter woesei DSM 14684 ECF41 ECF41s2

>ECFp1738 ECF41 ECF41s2 Conexibacter woesei DSM 14684

1 MDDSDWLAARFETDRTHLRAVAFRMLGSVSEADDAVQEAWLRLDRAGADD
51 VRNLTGWLTTVVARVCLDMLRSRTARREEPFGPHVPDPLVGREDRSDPEH
101 EALLADSVGLALLVVLEQLDPAERLAFVLHDMFAMPFDEIAPIVGRSPAA
151 ARQLASRARRSVRGQAPPPDPDIAEQRRVVDAFLAAAAGGDLAALMELLD
201 PDVVVRVDRSGLRPGTSREIRGAAAVAEVALSGGSRFGRFARPALVNGTA
251 GIVAAAGDRAFAVAGFSVVNGRIVEIDVVAGPARLRDLDLGDA

Name Aliases LCA Taxa Group Subgroup
ECFp1739
  • rpoE
  • RNA polymerase sigma-70 factor, ECF subfamily
  • ... more
Amycolatopsis mediterranei ECF41 ECF41s2

>ECFp1739 ECF41 ECF41s2 Amycolatopsis mediterranei

1 MNEELLARSFETHRDHLRSVAYRMLGSLTEAEDAVQESWLKLSRSDTAAV
51 ENLGGWLTTVVGRVCLDMLRSRKARREEPWDALVPDPIVSREDAGPEHEA
101 LMADSVGLALLVVLDTLTPAERLAFVLRDMFAMPFEEIASVVGRSEAATR
151 QLASRARRRVQGAPVAPDPDLARQREVVDAFLAAARGGDFDALVSVLDPE
201 VVLRADRGLARGGSTEVRGAAAVANQALTFSRLGAGGGVVHRALVNGAAG
251 VVATRAGRPFSVLGFTVAGGRIVEIDILADPDRLSRLDLAVLD

>ECFp17402 ECF41 ECF41s2 Myxococcus fulvus 124B02

1 MDEEIRRAREFESHRTHLRAVAYRMLGSVSEAEDAVQEAWLHVSRADTHE
51 VVNPRGWLTTVVARVCLDFLRTRNSRREESEDLQGVSRLENVPAASDPEQ
101 ESLMADSVGVALLVVLDALSPPERIAFVLHDMFSLSFDDIGPIVGRTSTA
151 TRQLASRARRRVHGAALSPDADLSRQRELVAAFHAAARGGDLDALLAVLD
201 PDVVARTDARVLPAGATREVRGAASVARQATLASARARFTQRALIDGQVG
251 LVIAPRGRLVSVLRFTVEGGRVVAIESIFDPERLRRLEVTVFPG

Name Aliases LCA Taxa Group Subgroup
ECFp1740
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Conexibacter woesei DSM 14684 ECF41 ECF41s2

>ECFp1740 ECF41 ECF41s2 Conexibacter woesei DSM 14684

1 MDDHEWIAEQFEGQRRHLNAVAYRMLGSRSEADDAVQEAWLRASRAGADE
51 VENLGGWLTTIVARVCLNMLRSRRTRHEVPLEEPEHVRVPDPLVSRAEGH
101 DPEQAALLADSVGLALLVVLETLGPAERLAFVLHDLFGMPFDEIAPIVDR
151 SPAATRQLASRARRRVRGAAPAPDPDLARQRVAVDAFFAAARDGDFDALV
201 AVLDPDVVLRTDGGLTRGASVVVRGAEAVAGRARAYARISASVHPALVNG
251 AAGVVVVASGRPFSIMGFTVADDRIVAIDALSDPARLAQLDLTAFGV

>ECFp17433 ECF41 ECF41s2 Streptomyces sp. NRRL S-350

1 MAERFEAERARLRTVAYRMLGSIAEAEDAVQEAWLKLSRSDVGEVRNLGA
51 WLTTVVGRVCLDQLRSRTSRREDPLPEQEGQPRLPDPVVSGLATPDPVHG
101 ILVADSVGIALMVVLETLSPAERVAFALHDLFDVPFDGISEVLGRTPAAT
151 RQLASRARRRVQGATPAADADNARKREVVEAFLAASRGGDFDALLTVLDP
201 GVVARSDGGTLVPSVLRRGAADVAAQAITFARFAADGRPVLVNGSPGVVS
251 FAEGRTLSVMSFTIHDGRITAMDILTDPTRLAALGLTA

Name Aliases LCA Taxa Group Subgroup
ECFp1751
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Streptosporangium roseum DSM 43021 ECF41 ECF41s2

>ECFp1751 ECF41 ECF41s2 Streptosporangium roseum DSM 43021

1 MDEHQWLTERFAEQRSHLRAVAFRMLGSLSEADDALQDAWLRASRADVGQ
51 VQNIAGWLTTVVARVCLNMLRSRGNRHEEPLDIQTADPLLGPASTGNPEQ
101 EVVMADSVGVALLVVLDTLSPAERVAFVLHDLFAVPFEEIAPMLERSPEA
151 TRQLASRARRRVKGAAPAPHVDLTRRREIVEAFLSATLGRDFQALITLLH
201 PDVMLRADKAVMLTAEPVVVHGAEPVAKGAMAAMQRAQFTGAALIDGAVG
251 LVMAPHSHLRVALTFTIADGLITAIDVIAEPDRLDRLHLAVLD

Name Aliases LCA Taxa Group Subgroup
ECFp17568
Sorangium cellulosum ECF41 ECF41s2

>ECFp17568 ECF41 ECF41s2 Sorangium cellulosum

1 MDENRWLAERFEAHRAHLRAVAYRMLGSVGEAEDAVQESWLHLSRADTSG
51 VENLGGWLTTVVARVCLDMLRSRKARREEPMAAPDPALDREAGTDPEREA
101 VLADSVGVALLVVLDTLTPAERLAFVLHDLFAVPFEEIASIVGRSPAAAR
151 QLASRARRRVQGAPPSPDADVGRQREVVDAFLAAMRGGDLDALVAILDPD
201 VVIRADATVAPPAGNEVRGARAWAKQAISGARGAKFARPALVDGAVGVVV
251 APNGRLFRVLRFTLAQGKIAQIDVMGDPEQLRDLDLSVLDGGPQPET

Name Aliases LCA Taxa Group Subgroup
ECFp17581
  • DNA-directed RNA polymerase sigma-70 factor
  • AAW13_RS03580
Streptomyces humi ECF41 ECF41s2

>ECFp17581 ECF41 ECF41s2 Streptomyces humi

1 MTMDTELLAGRFEEHRDHLRAVAYRMLGSLTEAEDAVQEAWFRLGRTDPD
51 EIRNLGGWLTTVVGRVCLDMLRSRTARREQPMDETFVPDPVIRPLSTIDP
101 EQEVLEADSVGLALLIVLETLEPAERLTFVLHDMFTVPFDDIAPIVERSP
151 AATRQLASRARRRVRGATPSADPDLGRQRRVLDAFLAASRGGDFEALVAL
201 LHPDVVLRVDSGALVRGAAASKLVRGSRSVAEQAFTFRQFAGTARLALVN
251 DTVGMVNTPADGPRSVMAVTVVDGRITGMYILADPERLARLEFTAEDD

Name Aliases LCA Taxa Group Subgroup
ECFp17678
  • hypothetical protein
  • RI57_RS05695
Promicromonosporaceae bacterium W15 ECF41 ECF41s2

>ECFp17678 ECF41 ECF41s2 Promicromonosporaceae bacterium W15

1 MTSRSTSPTSAAGPDRPDDDWLAQQFEAQRGRLRAVATRMLGDGAEAEDA
51 VQEAWFRLQRTGGDAIDNLSGWLTTVVSRVCLDHLRSRAARREDAWAPVE
101 ETAAVRPDATAPEPEGAALEADAVGAALQVVLDTLAPAERLAFVLHDLFG
151 VPFEQIAPIVERTPEATRQLASRARRRVRGSAFASGEAAVGPDGVEHVEA
201 PTLPADRARQREVVEAFLAASREGRFEDLLQVLDPDVVLHADPVAVEATA
251 RVVAQGLPAPVLSAEAHGAFAVATAFVGRALAARVALIDGEVGAAFVFQG
301 QVRSTFAVRVRDDRVVAVDVCGDPVALAAKDVVLLEVTPR

Name Aliases LCA Taxa Group Subgroup
ECFp17714
  • ECF subfamily RNA polymerase sigma-24 subunit
  • AFR_10190
  • ... more
Actinoplanes friuliensis DSM 7358 ECF41 ECF41s2

>ECFp17714 ECF41 ECF41s2 Actinoplanes friuliensis DSM 7358

1 MDQLARRFESDRPHLRAVAQRMLGSAAEADDAVQEAWLRLSRSDTSDVGN
51 LTGWLTTVVSRVCLDMLRSRASRREEDAELPETAAPDDAHPEHEALVADS
101 IGPALLVVLDTLAPGERLAFVLHDMFAVPFPEIAEIVGCSPAAARQLASR
151 ARRKVQGRGANSGSDRTRTRTVVEAFLAASRGGDFAALLALLDPDVVLHA
201 DDAAVRTGATAVLRGASAVAETFSGRAQGAKLAFLDGTAGLLWAPGGTPR
251 VAFAFTVAADGRITGIELIADAADLAAMDVQRVP

>ECFp17766 ECF41 ECF41s2 Caulobacter sp. CCH9-E1

1 MPPENYLAQRFEADRARLRGVAYRMLGSLPEAEDAVQEAWLRLSRTGGAG
51 VDNLSAWLTTVTSRVCLDMLRGRKARREDAIGEGAPEPSVAAEDAVERET
101 ILADSVGLALLVVLQALTPAERIAFVLHDLFDLPFDQIAPIVERTPEAAR
151 QLASRARRRVRGGQALDAAQTAQKSVVDAFLLASRTGDLAGLMAVLAPDV
201 VVRSDVLGGGGQVRELRGAEKVANFYNGLAQTARTALVDGAIGAVVAPLG
251 RMTRVLDFRVDNGRIVEIFVAGDPERLEAVEVAVV

>ECFp17807 ECF41 ECF41s2 Streptomyces sp. NRRL B-1140

1 MTGSEELARRFEEQRGHLKAVAYRMLGSLSEAEDAVQETWFKLSRTDTGD
51 IQNLGGWLTTVTGRVCLDMLRSRTARREEPMGGIQDTARAYVPDPVLRPL
101 SHIDPAEEVLQADSVGLALLVVLENLTPDERLAFVLHDMFAVPFDDIAPI
151 VERTPAATRQLASRARRRVRAATPSAEPDLGRQKQVLDAFLAASRAGDFE
201 ALLAVLHPDVLLRADSGALVRGAAASKLVQGARAVAEQALMFAPFTQAAE
251 LVLVNGSVGMVNAIEGRVQSVMGVTIVDGRITDLYILADPERLERLEVPW
301 PAV

Name Aliases LCA Taxa Group Subgroup
ECFp17836
  • hypothetical protein
  • H958_RS0129395
Solirubrobacter sp. URHD0082 ECF41 ECF41s2

>ECFp17836 ECF41 ECF41s2 Solirubrobacter sp. URHD0082

1 MPHETVHAEQFEQHRPRLQAVAYRMLGSVGEAEDAVQEAWLRLSRSDADA
51 IGNLGGWLTTVVGRVCIDMLRARQARHEAHMPEPIVIADEREDPEQEALL
101 ADSVGLALLVVLETLTPAERLAFVLHDMFAVPFDEIAPLVDRSPAAARQL
151 ASRARRRVRGAAPAPDADFTRRREIVAAFLAASRAGDFEALVAVLAPDAV
201 FRIDGRHVATGTADVARVASINGPRFAPGCRLGMVNGAPGIVVDGPEGTA
251 AVAGFTIAGGRIATIDLIRLGHPPA

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more