ECF proteins of ECF subgroup ECF41s2

Displaying ECF 121 - 140 of 1206 in total

>ECFp16182 ECF41 ECF41s2 Streptomyces sviceus ATCC 29083

1 MSERDWMAAQFEEHRPRLRAVAHRMLGSLGEADDALQDAWLRVDRADTSG
51 VENPGGWLTTVVARVCLNLLRARETRREEELSADRVPASAGRVTDPEEEA
101 LLADSVGLALLIVLDTLAPAERLAFVLHDMFQVPFDEIAPLIDKTPAATR
151 QLASRARRRVKGAPAPVAPAADASRRHRVVHAYLAATRGGDFDALLALLH
201 PDVVLHADRAVVPTPEPVLVRGARPVAEGAMASLGRARSAALVLVDGEIG
251 MAMLEEGRLRVLLRFTFDGDLIREIDVVAEPDRLRKAEVAVVEG

>ECFp16292 ECF41 ECF41s2 Streptomyces sp. NRRL S-340

1 MVDGTTGTTGATGTAAGEEALARRFEEHRGRLRAVAYRMLGSLAEAEDAV
51 QETWLKLTRTDTAGIGNLAAWLTTVTGRVCLDLLRTRGARREEPIDETFV
101 PDPLVRPLTTADPEQEALRGDSVGLALLVVLETLEPDERLAFVLHDLFAV
151 PFDDIAPVVDRTAAATRQLASRARRRVQGATPSAETDLKRQREVLEAFLA
201 ASRGGDFEALVAVLHPDAVLRVDAGALVRGAAGSKVVHGARTVAAQALTF
251 SRYAPTARLVLVNGAVGLANTPEDGPHSVMGVTVAEGRITHLYILSDPGR
301 LAHLGLREAMAD

Name Aliases LCA Taxa Group Subgroup
ECFp16329
  • RNA polymerase subunit sigma-70
  • AN963_06900
  • ... more
Brevibacillus choshinensis ECF41 ECF41s2

>ECFp16329 ECF41 ECF41s2 Brevibacillus choshinensis

1 MEDQKRLGELFEEHRSHLQAVAYRMLGSLSEADDAVQESWFRLSRSGTSH
51 IENIGGWLTTVVSRICLDMLRSRKSRREEPWEAFLPNQNINQGEESDPEY
101 EALLADSVGLALLVVLGNLNPAERISFVLHDIFDLPFQEIAPIVGRSQDA
151 TRQLASRARRRVQGVNSVTHPDITRQRELVDAFLAASRAGNFEALLSVLD
201 PNVVLWDDREVAIDGTVKELRGAQAVAKQVAGRAQAARPVLVNGTVGVVV
251 APNGRLLFVLDFTVKNSQITEIELVSDPSRLRQLDLSVLSE

Name Aliases LCA Taxa Group Subgroup
ECFp16333
Streptomyces katrae ECF41 ECF41s2

>ECFp16333 ECF41 ECF41s2 Streptomyces katrae

1 MDEKDELARRFDAHRAHLRAVAYRMLGSLGDADDAVQEAWFKLNRTDVGA
51 VENLGGWLTTVVGRVCLDMLRSRSARREESLDAADLPFRMPDPVVGLPGR
101 VDPEQEALLADSVGIALMVVLESLAPAERLAFVLHDMFAVPFEEIAPLVE
151 KSSAATRQLASRARRRVRGAAPAPDTDPVRVRRAVDAFLSAARDGDLEAL
201 VAVLDPEITARSDGGTRRPGALLRGARRVASQAIAFARFAQDGRAVLVNG
251 GPGVLALDADGHPVSLMAFTVRGGLITALDILTDPDRLACIRLDGA

>ECFp16385 ECF41 ECF41s2 Streptomyces

1 MNENASAQAVLAARFEEHRPRLNAVAYRMLGSLGESEDAVQEAWLRLSRT
51 EGAAGRGEGSGEVHNLGGWLTTVVGRICLDLLRSRQSRREDPLDTSERSA
101 LESHVPDPVVSRADAVDPEQEVLLADSVGLALLVVLETLAPAERLAFVLH
151 DMFAVPFDEIAPVVERSAAATRQLASRARRRVQGSAPAPETDVARQREVV
201 DAWMAATRAGDFEALLALLDPDVVLRADTGELSSGLSKVIRGAATVAGQA
251 AMFAALADHQYVVLVNGLPGLAAAPGGEVVSLGSFTVVDGRITEINIIAD
301 RDRLRELGIPAAGA

Name Aliases LCA Taxa Group Subgroup
ECFp16440
  • RNA polymerase, sigma subunit, ECF family
  • Mycsm_04868
Mycobacterium sp. JS623 ECF41 ECF41s2

>ECFp16440 ECF41 ECF41s2 Mycobacterium sp. JS623

1 MPEERFEEHRRHLRAVAYRMLGSLAEADDAVQEAWLRMHRSDVTDVRNMR
51 GWLTTVVARICLDMLRARSARSEEPLDEAPAIAADAVDPEAEAVLADSIG
101 VALLVILQTLSPAERLAFVLHDMFELPYAEIAPIVGRTENTAAQLAARAR
151 RRVRGKTPDPAMDLVRQRRLVDAFLAAAHDGDFDALLSVLDADVVLRVDA
201 AAAGTPTTLRGAQTIATNARAFSANARFAEPALVDGAVGIVVAPKGKLAL
251 VLRFAVAGDKITEIDIDADPQRLSAFELAVLD

>ECFp16514 ECF41 ECF41s2 Rhizobium

1 MNEKKWLADEFEANRAHLRAAAYRMLGSRSEAEDAVQEAWLRLSRTETSD
51 IGNLGGWLTTVVARICLDMLRARKSRREEPLDMPAHAGLADPAKDPEREA
101 AFADSVGLALLVVLQTLAPAERVAFVLHDMFDLPFDEIAPIIGRSSAATR
151 QLASRARRRVQGVGEAPEADFARKRTIAEAFLAASRNSDLEALLAVLAPD
201 VVFRPDATAARYGIGEMRGAADVAQAFKGRAQAAQIAVVDGEVGFVVDIG
251 GQIRVAVTLAIGDDRIVAIDAVADPDHLQRINYSILRD

Name Aliases LCA Taxa Group Subgroup
ECFp16601
  • DNA-directed RNA polymerase sigma-70 factor
  • IH07_RS0130905
Actinocatenispora sera ECF41 ECF41s2

>ECFp16601 ECF41 ECF41s2 Actinocatenispora sera

1 MDERDMLARRFEEQRPRLTAVAYRMLGSAVEAEDAVQEAWLRLARSDADV
51 VENLAGWLTTVVGRVCLDMLRSRTSRREASLDEQPAEPARTAPAETPESQ
101 ALLTDSIGLALLVVLQTLDPAERLAFVLHDMFAVPFEEIAPIVERTPAAA
151 RQLASRARRRVQGGTPQHPDVVRQRRIVDAFLSAARQGDFDALVSILDPD
201 VIIRSDGRFVRQGAATVARGATVFGPMAAVGIPILVDGRVGVVASMHGRE
251 YRILLFRFAGDRVAEFEVVSDQNRINAMELSTLD

Name Aliases LCA Taxa Group Subgroup
ECFp16660
  • DNA-directed RNA polymerase sigma-70 factor
  • IF12_RS0116855
Glycomyces sp. NRRL B-16210 ECF41 ECF41s2

>ECFp16660 ECF41 ECF41s2 Glycomyces sp. NRRL B-16210

1 MTADRDDQWLARRFEADRPRLEAVAFRMLGSSGEAEDAVQEAWFRLASSD
51 TGAIANLSGWLTTVVGRVCLDQLRRRKSRAEQPMPEHASDYGSGPVPLPD
101 PAPEADPESAALLADSVGLALLVVLETLEPAERLAFVLHDMFAVPFDEIG
151 RILDRTPVAARKLASRARARVRGNGGPPSRDVSRQRAVVEAFQEAARGGN
201 FDALVAVLDPEVTARTDGGTVGPILRGAAQIAGSAITFAALGTAGEMMLV
251 DGRIAVVAAPADQPTRMLVFTVESTPEGDRITALEGITNAENLRGRALTL
301 IEG

>ECFp16675 ECF41 ECF41s2 Bradyrhizobium elkanii CCBAU 05737

1 MDEKNSLTEQFEANRPRLRAVAYRMLGSTAEVDDAVQETWLRLGRTDAAA
51 VDNLGGWLTTVIARICLDMLRSRKSRREEPIGPHVPEPIADNPSERETEL
101 ADSVGAALLVVLETLAPAERLAFVLHDMFAVPFEEIAPIVGRTPAAARQL
151 ASRARRRVQGTPPAPDADLSRQRGIVEAFLAASRNGDFEGLLAVLAPDVV
201 VRADQAAQRLGSLPVIRGATAVAESFKGRAQAAKPALVDGEIGVAVIFGG
251 ALRIVLRVTISGDRIAAIDATADASEIETFDVEVLERS

>ECFp16683 ECF41 ECF41s2 Humibacillus sp. DSM 29435

1 MRGADDSDWLAERFDAQRGRLLGVAYRMLGSASEADDAVQEAWLRLSRTD
51 ADAVENLPAWLTTVVARVSLNMLRARATRREEPLEADVRERAISGGEGSD
101 PAQEALLADSVGLALLVVLDTLSPPERLAFVLHDMFDLPFAEIAPIVGRS
151 STSTRQLASRARRRVKGRTAGRPADLPRQRRVIEAYLAAVRGGDFEALVR
201 LLDPDVELRADAQATPQGASVELRGAQVVARAALVSSGRARYSSPALVSG
251 AVGVVMAPRGQLFLVLGFTFSGEAIIAIDVIADPERLRYLDLAVLD

>ECFp14370 ECF41 ECF41s2 Streptomyces leeuwenhoekii

1 MSGTQTLAGRFEAHRRHLQAVAYRMLGSLAEAEDAVQEAWLRLSRTDAAG
51 QADGIGNLGGWLTTVTGRICLDMLRARAARREEPMDDRPAAFVPDPLLRP
101 LPHDDPEQEALHADAVGLALLVVLETLEPAERLAFVLHDMFAVPFDDIAL
151 VVERSPAATRQLASRARRRVRAATPAADPDLGRQKKVLEAFLAASREGDF
201 DALLALLHPEVVLRADAGSVVRGAAATKLVHGARAVAEQAAMFSPFAHAA
251 RPALVNGAIGAVTVIEGRPLAVMGVTVADGRITGMYILADPRRLARLHLP
301 A

>ECFp16857 ECF41 ECF41s2 Streptomyces sp. NRRL S-237

1 MSEKEVLAQHFEEHRSHLRAVAYRMLGSLSEAEDAVQEAWLKLNRSDAAA
51 VENLGGWLTTVVGRVCLDMLRSRGTRREDPLHDQDGRVRIPDPIVSRADG
101 LDPEQEILLADSVGIALMVVLDTLAPAERLSFVLHDLFAVPFDEIAPVLG
151 RSAATTRQLASRARRRVQGAAPAPDPDRSRLRAIVDAFLAASRGGDFEAL
201 VAVLDPDVVARSDGGTLRPTLLRRGASDVASQAITFARFAEAAHPVLVNG
251 VPGVVAMAEGRALSVMAFTIQDGRITALDILTDPERLARIDLSVVQGG

>ECFp16856 ECF41 ECF41s2 Bradyrhizobium elkanii

1 MDEKNSLTEQFEANRPRLRAVAYRMLGSTAEVDDAVQETWLRLGRTDAAA
51 VDNLGGWLTTVIARICLDMLRSRKSRREEPIGPHVPEPIADNPSERETEM
101 ADSVGAALLVVLETLAPAERLAFVLHDMFAVPFEEIAPIVGRTPAAARQL
151 ASRARRRVQGTPPAPDADLSRQRGIVEAFLAASRNGDFEGLLAVLAPDVV
201 VRADQAAQRLGSLPVIRGAAAVAESFKGRAQAAKPALVDGEIGVAVIFGG
251 ALRIVLRVTISGDRIAAIDATADASEIETFDVEVLERN

>ECFp16924 ECF41 ECF41s2 Streptomyces sp. CNQ-525

1 MTACGERTGALTNEQDWLAERFESDRPRLRAVAYRMLGSVAEADDAVQEA
51 WIRLSRSDLGKVENLGGWVTTIVARVSLNMLKSRKSRSELLVDTTEGDGP
101 RDDVPPDDPQEEAVIADSIGLALLVVLDTLTPAERLAFVLHDMFAVPFEE
151 IATIVDRSPAAARQLASRARRRVRQSTPTERRGETFGVYDAGGSFAPGKS
201 DLATAFLAASREGNFEALLAMLDPDIVLRTDSVAVRMSLEAGMRGMQPIS
251 DVSEIRGADAVTRVFAGRTWNPTPAWIDGAAGLVWLVHGKPHVAFCFATE
301 NGRITAIDIKADLSGLGIDFG

>ECFp16940 ECF41 ECF41s2 Bradyrhizobium sp. Cp5.3

1 MTEENFLSRQFEANRKHLRAVAFRMLGSRGEVDDAVQETWLRLSRSDTSD
51 VANLRGWLTTVVARICLDMLRARKSRREDPMGPDVPEPVDDTREREAEMA
101 DSVGAALLIVLETLQPAERLAFVLHDMFAVPFEEIAPIVGRSVDASRQLA
151 SRARRRVQGAPVPETDLSHQRRIVEAFLAASREGNFEGLLAVLDPEVIVR
201 ADQAAVRLGSLPEIRGADAVAATFKGRAQAARPALVDGAMGVAVILSGHL
251 RIALRVSFKDDRIAAIEAVADAEQLAALDVEVLEP

>ECFp16956 ECF41 ECF41s2 Streptomyces sp. SPMA113

1 MNENRLLAEGFEAHRGHLRAVAYRMLGSLSEADDAVQEAWLRLSRSDTGA
51 VRNLGGWLTTVVGRVCLDMLRSRTARREEPLGVRLPDPVISGAGGPGPED
101 QALFADSVGLALLVVLETLAPAERLAFVLHDLFAVPFEEIAPIVDRTPAA
151 ARQLASRARRRVRGAAPVPDADLARQREVVDAFLAAARDGDFDGLIAVLD
201 PDVVLRADYGPAPARAPREVHGAAAVADQALTFSRLSGTDLRSRPALVNG
251 AVGVVSFREGRPFSVLAFTVTDGRIVAVDILADPGRLSGLDLADLD

>ECFp17169 ECF41 ECF41s2 Streptomyces sp. NRRL F-2580

1 MSEKDVLARSFEEHRPHLRAVAYRMLGSLSEAEDAVQEAWLKLSRSDAGA
51 VENLGGWLTTVVGRVCLDMLRSRTTRREDPLHDQDGEVRIPDPVVSRADG
101 LDPEQEVLLADSVGIALMVVLETLAPAERLAFVLHDLFAVPFDDIAPVLG
151 RTAATTRQLASRARRRVQGAAPAPDPDRARLRAVVEAFLAASRGGDFEAL
201 VAVLDPDVVARSDGGALRPGLVRRGAAEVASQAITFARFAAASHPVLVNG
251 LPGVVAVADGRAISVMAFTVRDGRITALDILTDPERLARIDLPLLEG

>ECFp171842 ECF41 ECF41s2 Rhodococcus jostii

1 MDDRDVPTDRFQEHRPRLQAVAYRMLGSASEADDAVQEAWLRMSRADTGD
51 VENLEAWLTTVVSRVCLNVLRSREQRREEPLDVQAHDPVVGHDAGGDPEH
101 EAMLADSVGLALLVVLDTLTPAERLAFVLHDMFDVPFDDVAPIVGRSSPA
151 VRQLASRARRRVKGAAPTPNSADPDSADLDRRRRVVDAYLAATRAGDFDA
201 LVALLDPDVVLRADAAVGPTPAPLVIRGARVVAKGALASAERARSTETAL
251 VNGTVGLVMAPRGRPYVVLTFTIVDGRITEIDVIAEPDRVRRLDLAPLGD

>ECFp172104 ECF41 ECF41s2 Bradyrhizobium sp. NAS96.2

1 MDEKKFLAEQFEANRPRLRAVAYRMLGSTAEVDDAVQEAWLRLGRTDAAA
51 VDNLGGWLTTVIARICLDMLRSRKSRREEPIGPHVPEPIADNPSERETEM
101 ADSVGAALLVVLETLAPAERLAFVLHDMFAVPFEEIAPIVGRTPAAARQL
151 ASRARRRVQGTPPAPDPDLSRQRGIVEAFLAASRNGDFEGLLAVLAPDVV
201 VRADQAAQRLGSLPVIRGAAAVAESFKGRAQAARPALVDGEIGVAVIFGG
251 KLRIVLRVTISGNRIAAIDATADAAEIETFDVEVLDHT

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more