ECF proteins of ECF subgroup ECF41s2

Displaying ECF 101 - 120 of 1206 in total
Name Aliases LCA Taxa Group Subgroup
ECFp14886
  • putative RNA polymerase sigma factor
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Saccharopolyspora erythraea ECF41 ECF41s2

>ECFp14886 ECF41 ECF41s2 Saccharopolyspora erythraea

1 MTAAMDENEFLADRFEAHRAHLRAVAYRMLGSHAEAEDAVQEAWLRLSRS
51 DTSEVANLGGWLTTVVGRVCLDVLRSRKSRREDPRGVHLPDEVAGGRDPA
101 TPEQQAVLADSVGQALLVVLDTLEPAERLAFVLHDMFAVPYDEIAPVVGR
151 STAAARQLASRARRRVQGTSPAGGAGTTEGDAARRREVVDAFLTAARGGD
201 LDALLAVLDPDVVLRADPAAVETAGASRAHGAPLLAGEIRGASAVADTFS
251 GRARGAQPALVDGVLAATYAPGGTPRVVFGFAVEDGRIVGIDVIADPARL
301 AELDVEPLEP

Name Aliases LCA Taxa Group Subgroup
ECFp14925
  • RNA polymerase subunit sigma-70
  • A8713_29125
  • ... more
Streptomyces sp. SAT1 ECF41 ECF41s2

>ECFp14925 ECF41 ECF41s2 Streptomyces sp. SAT1

1 MADGTGGGTAGTAGTADEERLARRFEEHRGQLRAVAYRMLGSLTEAEDAV
51 QETWLKLTRADSDAIGNLAGWLTTVTGRVCLDLLRSRTARREDPLDETFV
101 PDPVVRPLASADPEREALRGDSVGLALLVVLETLEPDERLAFVLHDLFAV
151 PFDDIAPVVERTAAATRQLASRARRRVQGATPSAETGLARQKEVLEAFLA
201 ASRGGDFEALVAVLHPDVVLRVDAGALARGAAASKVVRGARTVASQALTF
251 SRYAPTARLVLVNGAVGVANTPQAGPHSVMAVTVADGRITHLYILSDHDR
301 LAPLDLPAAMTG

Name Aliases LCA Taxa Group Subgroup
ECFp15127
  • hypothetical protein
  • B085_RS0136695
Streptomyces sp. BoleA5 ECF41 ECF41s2

>ECFp15127 ECF41 ECF41s2 Streptomyces sp. BoleA5

1 MDGEEFLAERFEDNRAHLRAVAYRMLGSLTEADDAVQEAWLRLNRAGADG
51 IENLGGWLTTVVGRVCLDMLRSRTSRGESPLDDVRVPDPVVSPPDAAGDP
101 EQAALLADSVGLALLVVLETLSPAERLAFVLHDMFAVPFEDIAPMVGRTP
151 TATRQLASRARRRVQGAAPAPDADLGRQRQVVRAFLAASHAGDFEALVAV
201 LHPDVVLRADTGAAFPGATREVRGARTVASQALTFRHAALHARPALVNGA
251 PGVVTVAEGRVVSVLGFTIVDGLVVELDILADPERLAGLDPAAFGE

Name Aliases LCA Taxa Group Subgroup
ECFp15257
  • RNA polymerase sigma 70
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Rhizobium leguminosarum bv. trifolii WSM1689 ECF41 ECF41s2

>ECFp15257 ECF41 ECF41s2 Rhizobium leguminosarum bv. trifolii WSM1689

1 MDEKKWLTEEFEANRAHLRAAAYRMLGSRSEAEDAVQEAWLRLSRTDTTG
51 VGNLGGWLTTVVARICLDMLRARKTRREEPLEAPVHAGIADPANDPEREA
101 AFADSVGLALLVVLQTLAPAERVAFVLHDMFDLPFDEIAPIIGRSSAATR
151 QLASRARRRVQGLDETPDVDFARKRTIAETFLAASRNGDLEALLAVLSPD
201 VVFRPDATAARYGIGEMRGSTDVAEAFKGRAQAAEPAVVDGELGFVVHIG
251 GQIRIAVTLAIGDGKIVAIDAVADPDRLRQINYSILQD

Name Aliases LCA Taxa Group Subgroup
ECFp15291
Nitratireductor soli ECF41 ECF41s2

>ECFp15291 ECF41 ECF41s2 Nitratireductor soli

1 MDENKFLAEQFEAKRGHLRGVAYRMLGSLNEAEDAVQEAWLRLARSDESE
51 IANLGGWLTTVVGRICLDMLRARKARREDPLEPGEPRSETGDPQAANPEE
101 EMAMADSVGLALLVVLEKLAPAERLAFVLHDMFAVPFEAIAPIVNRTPAA
151 ARQLASRARQRVQGKPALPAADRAAQRSVVDAFLAAARNGDFNALLSVLD
201 PEVMFRADGAAAQLGSLAEIRGAEAVANSFKGRAQGARPVLVDGALGLLV
251 APGGRLRIVLNLTIRDGRIAAINAIAEPAHLEALELAVLDD

>ECFp15329 ECF41 ECF41s2 Streptomyces lincolnensis

1 MTMGYDDFLAERFEAHRGHLRAVAHRMLGSVTEADDAVQEVWLRLSRTDA
51 RRIDNLGGWLTTVVGRVCLDMLRSRRSRAEEPLETAPQRPGTTTGPGPGP
101 GPGPVPDPEQDALLADSVGGALLVVLETLTPAERLAFVLHDLFAVSYDEI
151 AAVVGKSPPAARQLASRARRRVRGAQAPDADLARQREVVDAFLAAARAGE
201 FDALVAVLDPDVVARTEVGVTTGAAAVARGASRFSRGAGVPVPALVDGRT
251 GMAVFVDGRMDRVLSFTVVDERITVIDITTDPDRLAVLDVELLQEAPSSS
301 TPTVSPSTVSPLGRKPSRR

Name Aliases LCA Taxa Group Subgroup
ECFp15413
  • RNA polymerase subunit sigma-70
  • AS026_32630
  • ... more
Rhizobium altiplani ECF41 ECF41s2

>ECFp15413 ECF41 ECF41s2 Rhizobium altiplani

1 MDEKNWLAGEFEANRAHLGAVAYRMLGSRAEADDAVQEAWLRLGRSDADA
51 IDNIGGWLTTVVARICLDMLRSRKTRREEPFDLPVHERVADTSKTVDPER
101 EVAFADSVGMALLVILETLAPAERVAFVLHDMFDLPFDDIAPIIHRSSAA
151 TRQLASRARRRVQGKTDVPEADAARKKQIVQAFLAASRLGDIRALLSILD
201 PQVVFTPDTAAMRYNPSVRELRGADAVAETFRGRAQAAQPAMIDGEFGLV
251 VVVGGHLRVVLLLTFDGEKIAGIDAVANPDYLGNLKYDLL

Name Aliases LCA Taxa Group Subgroup
ECFp15465
Streptomyces canus ECF41 ECF41s2

>ECFp15465 ECF41 ECF41s2 Streptomyces canus

1 MGDDDFLAERFEAHRGQLRAVARRMLGSGAEAEDAVQETWVRMSRSDTTH
51 IDNLGGWLTTVVGRVCLDMLRSRRSRAEQPLEPEAPVPATVADPEQDVLL
101 ADSVGSALLVVLDTLTPAERLAFVLHDLFAVPYDEIAGVIGKSPAATRQL
151 ASRARRRVRGAQVTDTDRTRRRELVDAFLAAAREGDFDGLLEVLDPDVVV
201 RTEVGVTTGALAVAKGATSYSRHIVGVAVPALVEGRTGIALLRDGRVERT
251 LAFTFVHDRIAVIDITTDPVRAARLEITFA

>ECFp15475 ECF41 ECF41s2 Streptomyces durhamensis

1 MDDFTGDTERRLAARFEADRTHLTAVAHRLLGSAAEADDALQEAWLRARQ
51 ADLDAVQNLTGWLTTVVTRVCLNLLRARRNRREDFLDAYDHDHAHDAPSV
101 PAEAGDPAREALLADEVGVALLVVLDTLGPAERVAFVLHDMFAVPFEEIA
151 PLIEKTPAATRQLASRARRRVQGRPPARAADAARRHRAVEAFLAATRGGD
201 FTALVALLDPDVVLHADALVVPTSQPVTVRGAEPVAQGAMAAVARARFTG
251 VALLDGEFGLVMAPHGRPRLVLAFAFGTAGRITRIDVVAEPERLRGTRIA
301 VVDPEYPAGHAEAGRTEELDQ

>ECFp15483 ECF41 ECF41s2 Bradyrhizobium sp. CCGE-LA001

1 MTQENPEENFLTHQFEASRDHLRAVAYRMLGTRAEVDDAVQEAWLRVSRY
51 DMSDVANLRGWLTTVVARICLDMLRARKSRKEEPMGPHVPEPADETRERE
101 AEMADSVGAALLVVLETLQPAERLAFVLHDMFAVPFEEIAPIVGRSADAS
151 RQLASRARRRVQGAPVPETDLSRQRGIVDAFLKASREGDFEGLLAMLDPD
201 VVFRADDAAVRLGTLPEIRGADAVAQLYKGRARAARTALIDGEIGVAVIL
251 GGQLRIALRVAFKDDRIAAIDTIADAEQIAALEVEVL

>ECFp15488 ECF41 ECF41s2 Streptomyces sp. AA0539

1 MDGHEELAARFEEHRPRLRAMARRMLGSAAEAEDAVQEVWLRAARAGAAG
51 VENLGGWLTTITGRVCLNLLRSRGSRPEEPLPDGYERAAPHAAGPATGPE
101 EAALLADSVGAALVVVLETLSPAERLAFVLHDMFAVPYEEIAPIVGRGEA
151 ATRQLASRARRRVRGADPGAGGGAADAGRREVVRAFLAAAREGDLEGLVA
201 VLHPEVVLRSDDGSEVRGAARLARGASAFAAAYGGGRPALVDGRLAAVTR
251 SGGGAVAVAFFTVEDGRITAMDTVGDPVRLAAMEMRLLED

>ECFp15607 ECF41 ECF41s2 Streptomyces sp. NBRC 110027

1 MNDHEWLAERFEEERSRLRAVAYRMLGSLSEADDAVQEAWLRLSRTGGDD
51 VQNLGGWLTTVVGRVCLDQLRMRKARREDSLEVHVPEPVVSRPDTVDPEQ
101 EALLADSVGLALLVVLETLSPAERLAFVLHDMFAVPFDEVAPLVDRTPAA
151 ARQLASRARRRVQGATPAPDTDLARQREVVDAFLAASRGGDFDGLLAVLD
201 PDVVLRADAGGAPDGLSKLVRGARAVVEQALTFSRFAPFARPALVNGAPG
251 LVTAQGGQPLAVMGFTLAHGKIVEINILADLARLSRLDLSILDD

>ECFp15660 ECF41 ECF41s2 Streptomyces mirabilis

1 MGDPEFPAEPESSGGDKEFLAARFESHRSHLRAVAYRMLGSQAEADDAVQ
51 EAWFRLNRSDATRVENLGGWLTTVVGRVCLDMLRSRKSRAEEPLDAGAPV
101 PAGTPDPEQDALLADSMGVALLVVLETLTPAERLAFVLHDLFAVPYEEIA
151 SIVGRTPTAARQLASRARRRVQGAPVPDADLVRQREVVEAFLAAAREGDF
201 DALVEVLDPDVVARSEGAVTAGAAAVAAGASSFAHLAVFARAALVDGVPG
251 IAMVVDGRVERTLAFTIVRDRIAVIDIVLDPGKVADLDVRLL

>ECFp15721 ECF41 ECF41s2 Actinoplanes subtropicus

1 MDNVVLADQFEANRPRLRSVALRMLGNTAEADDAVQEAWLRLSRSGGDEV
51 ANLSAWLTTVVGRVCLDMLRSRTARREDEYAAEQPAAAASPEEQAMLADS
101 VGLALLVVLDTLTPAERLAFVLHDMFAVSFEEIAPIVGRSPDAARQLASR
151 ARRRVRTTPNAGTPADRRVVDAFLDASRGGDLGMLLALLDPDVEMRIGPV
201 SQQRGADGVARFFAGRAQAARPALLDGALGIAVVLEGAVKVALRVTIVDG
251 LITVLDAITDPTQLAALNVEVLQD

>ECFp15887 ECF41 ECF41s2 Streptomyces incarnatus

1 MSEHERQYRDDEFLAERFEGYRGHLRAVAYRMLGSAAEAEDAVQEAWFRL
51 SRSDTREVGNLGGWLTTVVGRVCLDMLRSRRSRGEEPLDTWRPGASAEPD
101 PAQDAVLADSVGLALLVVLDTLSPAERLAFVLHDLFGVPFDEVGGILGRS
151 PAAARQLASRARRRVRGADAPETDLVRQREVVDAFLAAAREGDFDGLLEV
201 LDPDVLARGEAGTTIGAAGVASGAKSFAHLARAARPALVDGATGLVVYAG
251 GRVERVLTFTFVADRIATIDIVTDPAGLSLLTIELA

Name Aliases LCA Taxa Group Subgroup
ECFp15973
  • DNA-directed RNA polymerase sigma-70 factor
  • OQ02_RS00660
Saccharothrix sp. NRRL B-16314 ECF41 ECF41s2

>ECFp15973 ECF41 ECF41s2 Saccharothrix sp. NRRL B-16314

1 MDDRDRPAERFEEHRPRLRAVAYRMLGSVAEADDAVQDAWLRLARTDVTS
51 VNNLGAWLTTVVARLCLNVLRAREQRREDSFEVHVPDPVVSYDDGSDPEH
101 EAVLADEVGLALLVVLDTLAPAERLAFVLHDMFAVPFEEIATLLERSPAA
151 TRQLASRARRRVQDRAPVPDADRALRREVVNAFFAAARDGDFGALVAVLD
201 PAVVLRSDAGIGSRHTVVVTGADSVAGQAVTFGKLYEFARPALVNGAAGV
251 VVVANGRPLSIMGFTVAGGRIVAIDVLADAERLHQLLVLPDQR

>ECFp16020 ECF41 ECF41s2 Streptomyces mirabilis

1 MNETELLADRFEEHRGQLRAVAYRMLGSLPEAEDAVQETWLKLSRTDADG
51 IRNLGGWLTTVAGRICLDMLRSRTSRREEPIDETFVPDPLLRPLTEIDPE
101 QEVLQADSVGLALLVVLETLEPDERLAFVLHDMFAVPFDDIAPIVERTSA
151 ATRQLASRARRRVQGASPSGDPDLARQREVVEAFLAAARAGDFDALVALL
201 HPDVALRADSGALVRGAAASKALRGARTVAEQALMFAPIAQYAQLALVNG
251 SVGVVNAAEGQALAVMGVTVADGRITGMYILADPDRLARLDLTALEK

Name Aliases LCA Taxa Group Subgroup
ECFp1609
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Stackebrandtia nassauensis DSM 44728 ECF41 ECF41s2

>ECFp1609 ECF41 ECF41s2 Stackebrandtia nassauensis DSM 44728

1 MVDELGEAARRFEENRARLRAVAYRMLGSLAEAEDAVQETWLRYSRADTA
51 EVANLPGWLTTVTGRVCLNMLRARRTRREVSIDAVTDDGRRGADTELERH
101 PATDADPEREAVMADSVGLALLVLLDTLSPGERLAFVLHDMFTVPFEEIA
151 PLVDRSAAATRQLASRARRRVKGGAAVSRAELDRQRPVVDAFLTAVRGAD
201 LEALVALLDPSVTLRADRHVVPSARPITISGATTVAETAMAATGRARFTG
251 LVLIDGAVGLLMAPGGRLRLVLRFGFDGERITGIDVVADPARLAELELAV
301 VGD

>ECFp16130 ECF41 ECF41s2 Streptomyces agglomeratus

1 MTDHEFLAERFEAHRGHLRAVAYRMLGSLSEAEDAVQEAWLKLSRSDTTD
51 VANLGGWLTTVVGRVCLDMLRSRTSRREDPLDVHAYTHVPDPVIGRADKA
101 DPEQQALLTDSVGLALLVVLETLPPAERLAFVLHDMFAVPFDDIAPVVER
151 TPAATRQLASRARRRVQGARPPEADRGRQRQVVDAFLAASREGDFDALLA
201 LLDPDVVLRADAGAVTPATAGTVFASRVVRGARTVVEQALTFSRFAPYAR
251 PALVNGALGLVTATGGQTYSVMDFTLRDGKIVEINILADRDRLSRLEVPA
301 LDG

Name Aliases LCA Taxa Group Subgroup
ECFp16178
  • RNA polymerase subunit sigma-70
  • IH35_RS0133185
Microtetraspora glauca ECF41 ECF41s2

>ECFp16178 ECF41 ECF41s2 Microtetraspora glauca

1 MEGTGGSGAGTGGGAGGGDSDADALARRFDADRGHLRAVAYRMLGSLSEA
51 EDAVQETWFKLSRTDVSGVANLTGWLTTVIGRVCLDMLRSRGSRREDPLD
101 HFVPDPIVHVPGAGDPEHAAELTESVGLALLVVLETLAPAERLAFVLHDM
151 FAVAFDEIAPIVDRTPAATRQLASRARRRVQDAAPGPGPDARRQREIADA
201 FLAASQGGDFEGLLAVLDPDAVLRADGGKLLAGASKLVRGAEAITRQALM
251 YATFRKASLPLVVNGQPAVLSVVDGKPSALMAFTVVGDRIVELHVLADPE
301 RIAALDIPEEALARAVYPDGD

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more