ECF proteins of ECF subgroup ECF41s2

Displaying ECF 1141 - 1160 of 1206 in total
Name Aliases LCA Taxa Group Subgroup
ECFp12982
  • RNA polymerase subunit sigma-70
  • LMTR13_34415
Bradyrhizobium icense ECF41 ECF41s2

>ECFp12982 ECF41 ECF41s2 Bradyrhizobium icense

1 MDEKKFLAEKFEANRPHLRAVAYRMLGSTSEVDDAVQETWLRLSRSDTSA
51 VENLGGWLTTVVARVCLDMLRSRKSRREEPMGPHVPEPVADDMHGRDAEM
101 ADSVGAALLVVLETLAPAERLAFVLHDTFAVPFEEIAPIVGRTPAAARQL
151 ASRARRRVQGSPPPDADFGRQKNIVDAFIKASREGDFEGLLTVLDPDVVF
201 RADAAAQRLGSLAEIRGAAAVAEAFKGRAQSARPALVDGALALAVILGGQ
251 LRIVVRLTISGERISAVEAVADAERIGQLDVNLLA

Name Aliases LCA Taxa Group Subgroup
ECFp14616
  • RNA polymerase sigma 70
  • ADK54_07805
Streptomyces sp. WM6378 ECF41 ECF41s2

>ECFp14616 ECF41 ECF41s2 Streptomyces sp. WM6378

1 MPETDDDEYLAQRFEEHRGHLRAVAYRMLGSLSEAEDAVQEGWLRASRAD
51 SGAVDNLGGWLTTIVGRICLNMLRSRSTRREAALDVEEYEYVHVPDPIVG
101 PVDVVDPEQEVLLADSVGLALMVVLETLSPAERLSFVLHDMFAVPFEDIA
151 PIVDKTPAATRQLASRARRRVQGRAPSPSVDRARQREVVDAFISAARGGD
201 FEALLALLDPDVLLRADAGSLPATKLVRGARVVAEQAYTFRKFAALNRPV
251 LINGMPGIVAAKDGRAFSLLSFTLGEDGRITELNILADPKRMAELDVSFL
301 TG

>ECFp14617 ECF41 ECF41s2 Amycolatopsis regifaucium

1 MDERDRLAERFEEHRTRLRAVAYRMLGSASEAEDAVQDTWLRLNRTDAGE
51 IENLGGWLTTVVARVCLNVLRSRDHRREEPLDAASSEPADSSVDLAADAV
101 LADSVGLAMLVVLDTLVPAERLAFVLHDMFAVPFDEIAPLIDRTPAAARQ
151 LASRARRRVQRRPATAEPDLARRRQAVDAYLAAARGGDFEALLELLHPDV
201 VLRADKAAGPSRAPIFLRGVDTVARGAAAASVRAAVTQLALVNGGIGLVM
251 ADEGLPSVVLAFAFVDGKIAEIDVMADRDRLRTLDLVILD

>ECFp14626 ECF41 ECF41s2 Streptomyces rubellomurinus

1 MTGKDFLADGFEAERAQLRSVAYRMLGSVAEAEDAVQEAWLRLERSDVSE
51 VRNLGAWLTTVVGRICLDQLRSRASRKEDPLPEEDGRVRLPDPVIGGLVA
101 LDPVQEILVADSVGLALMVVLETLSPAERVAFVLHDLFEVPFDAIADVLG
151 RTSAATRQLASRARRRVQGATPAADTDTGRKQQVVEAFLAAARGGDFEAL
201 LTVLDPDVLARSDGGTLVPGVLRRGAAEVASQAITFARFAAEARLVLVNG
251 SPGVVSYAEGRPLSVMSFTIHAGRITGLDILTDPTRLAALAPTP

>ECFp14677 ECF41 ECF41s2 Streptomyces sp. NBRC 110468

1 MATGDDDFLAERFEAHRSRLRAVAHRMLGSAAEADDAVQEAWVRLSRSGG
51 GSAGREIDNLAGWLTTVVGRVCLDMLRSRRSRAEEPLENWTPASSEVADP
101 AQDALLADSVGVALLVVLDTLTPGERLAFVLHDLFGVPYEEVASIVDRTP
151 EAARQLASRARRRVRGAQEPDVDLARQRKVVDAFLAAARDGDFDGLLAVL
201 DPDVVARSEAGVVTGAAAVASGASSFAFVGAVARNALIDGATGLAVLFEG
251 RVERTLSFTFVRGGRIAVIDVVSDLDRISELDVTLV

Name Aliases LCA Taxa Group Subgroup
ECFp15109
Streptomyces sp. 769 ECF41 ECF41s2

>ECFp15109 ECF41 ECF41s2 Streptomyces sp. 769

1 MSEENFLADRFEAERSGLRAVAYRMLGSLAEAEDAVQETWLKLGRTDVSE
51 VKNLGAWLTTVVGRVCLDMLRSRTSRREDPLPEQDGPVRLPDPVVTQLGR
101 VDPEREVLVADAVGIALMVVLETLSPAERLAFVLHDMFDVPFDEIAAILG
151 RTTVSTRQLASRARRRVQGATPAADVDNARKRDVVDAFLTASRGGDFEAL
201 LAVLDPAVVARSDGGTLVPSIVRRGASDVASQAITFARFAANAHLALVNG
251 TPGVVSFAEGRALSVMSFTIRDGRIIGLDILTDPDRLAELGLTV

>ECFp15151 ECF41 ECF41s2 Streptomyces

1 MRGQQRLAERFEEHRGQLKAVAYRMLGSLAEAEDAVQEAWLRLDRAGGDG
51 VDNLGAWLTTVTGRICLDLLRSRTARREEPMSEGFDTFVPEPVVSALPRT
101 DPEQEALHTDSVGIALLVVLETLEPAERLAFVLHDMFAVPFDDIAPVVER
151 SPAATRQLASRARRRVREATPAAEPDLGRQRQAVEAFLAASRAGDFEALV
201 AVLHPDVVLRADAGALARGVAASKVVRGARTVATGAFHFRHLAGLARVVL
251 VNGAVGTVAVSGGQPRSVTCVTVADGLITGLYILSDPERLARLDLSALEV

>ECFp15360 ECF41 ECF41s2 Streptomyces sp. NRRL F-5193

1 MDDSTVEHTGGPDADALARRFDADRGHLRAVAYRMLGSLSEAEDAVQETW
51 FKLSRTDVSGVANLTGWLTTVIGRVCLDMLRSRGSRREDPLDHHVPDPIV
101 HVPGAGDPEHAAELTESVGLALLIVLETLAPAERLAFVLHDMFAVSFDEI
151 ARIVDRTPAATRQLASRARRRVQDATPGPGPDARRQREIADAFLAASQGG
201 DFEGLLAVLDPDAVLRADGGVLLAGTSKLVHGAEAIIRQAVMYASFRKAS
251 LSIVVNGQPAVLSVVDGKATALMAFTIAGDRIVQLHVLADPDRIAALGIP
301 QEALDRAVYPD

>ECFp15366 ECF41 ECF41s2 Streptomyces sp. NRRL WC-3626

1 MEGELLAERFEEHRGHLKAVAYRMLGSVTEAEDAVQEAWLRLGRSDTDVI
51 DNLGGWLTTVTGRICLDLLRARAARREQPMDETFVPDPVIRPLSQVDPEQ
101 EALRADSVGVAMLVVLETLQPDERLAFVLHDMFAVPFDDIAPVVERSPAA
151 TRQLAGRARRRVRDATPPSDPDLGRQRRVLEAFMAAARAGDFEALVAVLH
201 PDVVLRADAGPLIQGVAGSKLLRGAKPVAESAMLFARFTAAGQLALLNDS
251 MGLLTVVDGRLASTLSITIADNQITAMYILANPTRLTHLTPHP

>ECFp15677 ECF41 ECF41s2 Streptomyces virginiae

1 MSEKEVLAQRFEEHRSHLRAVAYRMLGSLSEAEDAVQEAWLKLNRSDAAA
51 VENLGGWLTTVVGRVCLDMLRSRGTRREDPLHDQDGLVRIPDPIVSRADG
101 LDPEQEILLADSVGIALMVVLDTLAPAERLSFVLHDLFAVPFDEIAPVLG
151 RSAATTRQLASRARRRVQGAAPAPDPDRSRLRAIVDAFLAASRGGDFDAL
201 VAVLDPDVVARSDGGTLRPTLLRRGAAEVASQAITFARFAEAAHAALVNG
251 VPGVVAMAEGRALSVMAFTIRDGRITALDILTDPERLARLDLSVVESG

>ECFp15679 ECF41 ECF41s2 Streptomyces yokosukanensis

1 MDDCTEDAGRRLAARFEADRPHLAAVAHRLLGSATEADDALQEAWLRARE
51 ADLGEVRNLTGWLTTVVTRVCLNLLRARRNRREEFLDAHDSAAHDSAHDS
101 DHGTLSVAAEAGDPAREALLADEVGVALLVVLDTLGPAERVAFVLHDLFA
151 VPFEEIAPLVERTPAATRQLASRARRRVQGRPPVSSADAVRRHRAVEAFL
201 AATRGGDFTALVALLDPDVVLHADARVVPTPEPITVRGAVPVAQGAMAAV
251 DRARFTGLALLDGEFGLVMAPYGRPRVVLAFAFGADGRITRIDVVAEPER
301 LRGTEIAVVDPAHPEAVGPGEVDQRDGGEVDRDTAPPRD

>ECFp15995 ECF41 ECF41s2 Bradyrhizobium yuanmingense CCBAU 35157

1 MTEENFLTEQFEASRDHLRAVAYRMLGSRAEVDDAVQEAWLRVSRYDLSD
51 IANLRGWLTTVVARICLDMLRARKSRREDPMGSHVPEPVDDTREREAEMA
101 DSVGAALLVVLETLQPAERLAFVLHDMFAVPFEEIAPIVGRSVDASRQLA
151 SRARRRVQGAPVPETDRTQQRRIVNAFLKASREGNFEGLLAVLDPDVVFR
201 ADQAAVRLGSLAEVRGAEAVAQLYKGRARTARTALVDGEMGAAVILGGQL
251 RVALRVTFAGERIGAIEAVADADDIAAMEVQVLDGSDPDPLSRKQPHAQ

>ECFp172095 ECF41 ECF41s2 Streptomyces sp. CB01883

1 MDDFTGDAGQRLAARFEADRPHLTAVAYRLLGSATEADDALQEAWLRARQ
51 ADTGEVGNLTGWLTTVVTRVCLNLLRARRNRREDALDAHDSPAAAVTESG
101 DPAREALLADEVGIALLVVLDALSPAERVAFVLHDMFAVPFEEIAPLIDR
151 NPAATRQLASRARRRVRGREPVPTAGAGRRREAVEAFLAATRRGDFTALF
201 ALLAPDVVLRADALVVPTPEPLTVQGAEPVARGAMAAVARARLTGVALLD
251 GRIGLVMAERGHPRLVLAFTFGTEGLITGIDITADPERLRAIDIGPADTG
301 R

>ECFp172890 ECF41 ECF41s2 Streptomyces sp. 1222.5

1 MDDFTGDAGQRLAERFEADRPHLAAVAYRLLGSATEADDALQEAWLRARQ
51 ADTGEVGNLTGWLTTVVTRVCLNLLRARRNRREDALDAHDSPAAAVTESG
101 DPAREALLADEVGIALLVVLDTLSPAERVAFVLHDMFAVPFEEIAPLIER
151 NPAATRQLASRARRRVRGREPVPTADAGRRRAAVEAFLAATRGGDFTALF
201 ALLAPDVALRADALVVPTPEPLTVQGAEPVARGAMAAMARARLTGVALLD
251 GRVGLVMAERGHPRLVLAFTFGTDGLISGIDITADPERLRGIDIGPADTD
301 R

>ECFp12849 ECF41 ECF41s2 Streptomyces rimosus subsp. rimosus

1 MDENEFLAQRFEEHRAHLRAVAYRMLGSLSEADDAVQEAWLRLNRSDTSG
51 VGNLGGWLTTVVGRVCLDMLRTRTARGEESLDVRVPDPVIGGGADGIDPE
101 HQALLADSVGLALLVVLQTLAPAERLAFVLHDMFAVPFEEIGPVVGRTPA
151 AARQLASRARRRVRGTATPDTDLARQREVVDAFMAASRGGDFEALVAVLD
201 PDVVLRADTGAGFPGLAATARGAREVAGRAFMFRRFAHLARPALVNGAMG
251 IVTVADGGPVSVMGLTIAGGKIVAIDILADPERLRGLGLGLGPDVEVAEE
301 RAGRG

Name Aliases LCA Taxa Group Subgroup
ECFp13083
Rhodococcus sp. LB1 ECF41 ECF41s2

>ECFp13083 ECF41 ECF41s2 Rhodococcus sp. LB1

1 MNDNEVLAHRFEENRTHLSAVAYRMLGSLSEAEDAVQEGWLRLSRADASD
51 VENLPGWLTTVVARVCLDMLRSRKTRREEPLDVHVPDPIVSELDGADPEH
101 EAVLGDSVGLALMVVLDTLTPAERIAFVLHDMFALSFDEIAPIAGRTPAA
151 SRQLASRARRRVQGSGPVADTDLTRQREVVEAFMAASRGGRFDDLLALLD
201 PDIVLRADGGADGSSLVRGARAVSEQALTFSRFAPFARLALVNGAAGVVT
251 APEGKAMSVMAFTVAGGKIARIDILADPQRLQRLGLSAVDD

>ECFp13095 ECF41 ECF41s2 Streptomyces rimosus subsp. rimosus

1 MDENDSLAERFEEHRAHLRAVAYRMLGSLSEADDAVQESWLRLSRSDVSG
51 VGNLGGWLTTVVGRVCLDMLRSRTARGEESLDVRVPDPVVGGADGIDPEH
101 QALLADSVGLALLVVLQTLAPAERLAFVLHDMFAVPFEEIGPVVGRTPAA
151 ARQLASRARRRVRGTATPDTDLARQREVVDAFMAASRGGDFEALVAVLDP
201 DVVLRADTGAGFPGLAATARGAREVAGRAFMFRRFAHFARPALVNGAMGI
251 VTVADGGPVSVMGLTIAGGKIVAIDILADPERLRGLGLGPEVEREGRG

>ECFp13111 ECF41 ECF41s2 Streptomyces rimosus subsp. rimosus

1 MDENDFLAERFEEHRAHLRAVAYRMLGSLSEADDAVQESWLRLSRSDVSG
51 VGNLGGWLTTVVGRVCLDMLRSRTARGEESLDVRVPDPVVGGGADGIDPE
101 HQALLADSVGLALLVVLQTLAPAERLAFVLHDMFAVPFEEIGPVVGRTPA
151 AARQLASRARRRVRGTATPDTDLARQREVVDAFMAASRGGDFEALVAVLD
201 PDVVLRADTGAGFPGLAATARGAREVAGRAFMFRRFAHFARPALVNGAMG
251 IVTVADGGPVSVMGLTIAGGKIVAIDILADPERLRGLGLELGPEVEREGR
301 G

Name Aliases LCA Taxa Group Subgroup
ECFp13242
  • RNA polymerase subunit sigma-70
  • OO63_RS28985
Streptomyces ECF41 ECF41s2

>ECFp13242 ECF41 ECF41s2 Streptomyces

1 MDGRDLLAQRFEEHRPRLRAVAYRMLGSLSEAEDAVQETWLKLSRADDER
51 VENLGGWLTTVIGRVCLDLLRSRKQRGEQPLDVQGADTHVPDPEVSPLPG
101 GRDAVDPEQEALLADSVGLALLVVLDTLSPAERLAFVLHDMFAVPFEDIA
151 PIVERAPAATRQLASRARRRVRDADRTPGPDSDRTRQRKVVEAFLAAARK
201 GDFDALLELLDPGVVLRADGGGAEGLSRLVRGATAVVAGARSFATLAPTT
251 YLALVNGKVGQIAVHNGEPFSVGEFTVRDGRIVEINILADQERLRDLVDE
301 RTVAAVMSAGSVGDAGGGSGVAAGADATPEAVDGAPPAAD

Name Aliases LCA Taxa Group Subgroup
ECFp13816
  • DNA-directed RNA polymerase sigma-70 factor
  • YWW_RS0126735
Glycomyces tenuis ECF41 ECF41s2

>ECFp13816 ECF41 ECF41s2 Glycomyces tenuis

1 MSERTDLAERFEEQRPRLRAVAYRMLGSFSEADDALQEAWLRAGRTDTGE
51 VDNLGGWLTTVTARVCLNMLRSRRRRREEPIDVHVPDPVVSPESGLDPEH
101 EALLADSVGLALQVVLETLAPAERLAFVLHDMFAVPFEDIAGVIEKSPAA
151 ARQLASRARRRLEGRTAAETDPRRQREAVAAFFAASHRGDFDALVAVLDP
201 DVVLRADGGTARPALNTILRGAQTVAGQAALYRRFVPLAHPVLVNGAVGR
251 LIVDESGPFAVMSFTVADGRITAIDVLADPERLRRLDLPNPDERDR

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more