ECF proteins of ECF subgroup ECF41s2

Displaying ECF 1101 - 1120 of 1206 in total

>ECFp19608 ECF41 ECF41s2 Streptomyces silvensis

1 MNAGELLATRFEEHRPRLKAVAYRMLGSLSEAEDAVQETWLKLSRTDDER
51 VENLGGWLTTVVGRVCLDLLRSRKQRGEQPLDTEAPATHVPDPQISPLPG
101 GGEAVDPEQEALLSDSVGLALLVVLDTLSPAERLAFVLHDMFAVPFDDIA
151 PIVERAPAATRQLASRARRRVRGAAPEPGPDRTRHREVVEAFLAAARGGD
201 FDALLELLDPDVVLRADGGDVSGLSRFVRGAPEVVAGARSFSTLAATTYL
251 ALVNGRVGQIAVHDGQAFSVGEFTVRDGRIVEINILADQERLRALLDARA
301 IAELAAAD

Name Aliases LCA Taxa Group Subgroup
ECFp19603
Streptomyces bicolor ECF41 ECF41s2

>ECFp19603 ECF41 ECF41s2 Streptomyces bicolor

1 MSDTDFLARRFEAHRGHLRAVAHRMLGSAAEAEDAVQEAWFRVSRSDTTR
51 VDNLGGWLTTVVGRVCLDMLRSRRSRAEEPLDATAPPPTAPTASATVPDP
101 EQDALLADSVGAALLVVLDTLTPAERLAFVLHDLFGVSYGEVAAVVDRTP
151 TAARQLASRARRRVQGVDASEAVRAGQCRQREVVDAFLAAAREGDFEGLL
201 DVLDPDVVARTEVGVTTGAAAVARGAATFGPLAGVARPALVDGVPGGVVF
251 AEGRVERALRFAFVRDRIAVIDIVTDPARVARLDIRTV

>ECFp19615 ECF41 ECF41s2 Streptomyces sp. CNQ329

1 MRALSYRMLGSVAEAEDAVQEAWIRLSRSRTDEVENLSGWLTTIVARVSL
51 NMLQSRKSRPEDLVDTTETAEPDGDAAATDPEEEAVLADSVGVALLVVLD
101 TLTPAERLAFVLHDMFAVPFDQIAAIVDRSPAAARQLASRARRRVQQGAP
151 LARTRAIGVYDENGLTLKKGRSDLANAFLAASRQGNFEALLAMLDPDIVL
201 RSDATAVQLGLEAELHGADAVTRLFAGHAWAPLPAVVDKAPALVWVKDGE
251 PYLSFRFTVGDGDGRITEIGVQAELTDLDIELAL

>ECFp19616 ECF41 ECF41s2 Streptomyces hygroscopicus subsp. hygroscopicus

1 MDENHLLAEGFEAHRGHLRAVAYRMLGSLSEADDAVQEAWLRLSRSDTGA
51 VENLGGWLTTVVGRVCLDMLRSRTARREEPLGVRIPDPVVSGESGPGPED
101 QALLADSVGLALLVVLETLGPAERLAFVLHDLFGVPFDEIAPIVDRTPAA
151 ARQLASRARRRVRGAAPAPDPDLARQREVVDAFLAAARGGDMEGLIALLD
201 PDVVLRADYGGAPAAPAPREVRGAAAVANQALTFSRLSGSGLLTRPALVN
251 GAVGLVSSREGRPFSVLAFTVVDGRIVAIDILADPERLDGLDLTDLN

Name Aliases LCA Taxa Group Subgroup
ECFp19632
  • DNA-directed RNA polymerase sigma-70 factor
  • B056_RS0106390
Frankia discariae ECF41 ECF41s2

>ECFp19632 ECF41 ECF41s2 Frankia discariae

1 MTDPAWCAEQFERQRPQLRAVAYRMLGSFADADDAVQEAWLRLSRADGTA
51 INNLAGWLTTVVGRVCVDLLRARRARREDLPGTWLPDPVIIETDSPDPEQ
101 HVLLADSVGLALLVVLDSLQPAERLAFVLHDMFGVPFDDIAPVLERTPAA
151 TRQLASRARRRVQGSGTRPDPDLPTQRRVAEAFLAAARDGDFAALVGLLD
201 PNVRLRVDTGPRAWLAPRLLTGAGDVAGHAAAQGPRFAGLWEPALVNGAA
251 GMIARGRAGLIAVVGLTVVNGRIREIDLILDADRLAAVDVNR

Name Aliases LCA Taxa Group Subgroup
ECFp1963
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Geodermatophilus obscurus DSM 43160 ECF41 ECF41s2

>ECFp1963 ECF41 ECF41s2 Geodermatophilus obscurus DSM 43160

1 MSGNDVLAAQFEEHRHRLTAVASRLLGSRAEAEDAVQEAWLRVSRAGSDE
51 VADLGGWLTTVVARVALNQLRARANRREDPYDDALPARLHANADPAQEAV
101 LTDSVGLALLVVLDQLAPAERLAFVLHDLFDVPFDEIAPIVDRSPAAARQ
151 LASRARRRVRGAELPDATERRREVVAAFLDASRDGDFSALLELLHPEAVL
201 RSDAVAARMGAAAEVRGAAGVARFLSGRARAARLVLVDGVPGAVWSLRGT
251 PQVVFAFTVEDGVVTAIDLLAAPGTLSGLDLHPLRQR

>ECFp19675 ECF41 ECF41s2 Mycobacterium sp. 852002-51961_SCH5331710

1 MIDEHLRTFDEHRDHLHAVAYRMLGSASDADDAVQEAWLRMRRADVGAVR
51 NLGGWLTTVVARICLDMLRARAARAEQPLDDLGEGDAPPASGFDPEQEAV
101 LADSVGVALLVVLHTLSPDERLAFVLHDMFDLPFAEIAPIVGRSENTAAQ
151 LASRARRRVRGQDAPQATEFVRQRHLVDAFLAATRNGDFDALLALLHTDA
201 VLHVDASAGGIATTVRGAHAIAGNAQRFAANARFAEPAVIDGAPGVVVAP
251 AGRLRLVLRFTVTDDRIGGITIDADPHRLSHLQLALLGR

Name Aliases LCA Taxa Group Subgroup
ECFp19700
Rhizobium sp. YR060 ECF41 ECF41s2

>ECFp19700 ECF41 ECF41s2 Rhizobium sp. YR060

1 MDEKKWQAEKFEANRPYLRAVAYRMLGSRTEAEDAVQEAWLRLNRANTSE
51 IDNLGGWLTTVTARICLDWLRSRKSRREEPLTIRVPEPVVSHEAGNGTDP
101 EQEALLTDSVGLALLVILEKLTPAERLAFVLHDMFDMAFDDIAPIVGRST
151 VATRQLASRARRRVQGVPVAAEADLSRQRHVVDAFFAASRNGDMTALLTA
201 LDPDVVFRADAVATRMGALAEIRGNSAVAETFRGRAQGARLAVINGAVGA
251 VVILGGQLRIALRITMADDGRIIGIDAMADPEQLRKLEVLLLDP

Name Aliases LCA Taxa Group Subgroup
ECFp19720
  • DNA-directed RNA polymerase sigma-70 factor
  • P696_RS0112200
Actinomadura oligospora ATCC 43269 ECF41 ECF41s2

>ECFp19720 ECF41 ECF41s2 Actinomadura oligospora ATCC 43269

1 MTPHDFLAAEFEGHRPHLKAVAYRMLGSLAEADDAVQEAWLRLARSDAGD
51 IDNLGGWLTTVVGRVCLDMLRARRIRGERSLEEHLPDPVITREDGGDPEE
101 QVMLADSVGLALLVVLESLSPAERLAFVLHDMFGMPFAQIARIVDRTPDA
151 TKKLASRARLRVRGAAAVPDPDPVGQRQAVDAFLAAARGGDFDALLGLLD
201 PEVVLRADAGLPAGGMKVVRGAGAVAAQAATFRRMATAADAHPALVNGNA
251 GLVNILGGRLFSVMSFTVSGGRIVAIDILSDPDRLARLDLIALDGLDVLP
301 GD

Name Aliases LCA Taxa Group Subgroup
ECFp19719
  • DNA-directed RNA polymerase sigma-70 factor
  • G569_RS0139935
Solirubrobacter soli DSM 22325 ECF41 ECF41s2

>ECFp19719 ECF41 ECF41s2 Solirubrobacter soli DSM 22325

1 MTDADFLAMQFETHRPHLRKVAYRMLGSLTEADDAVQEAWLRLSRSDASE
51 IENLRAWLTTVVARVSLNALRARNTRAEAPLDEIYVPDPLITSDVDPEHE
101 ALLADSVGLALLVVLETLTPAERLAFVLHDMFAMPFDEIAPMVGRTSTAT
151 RQLASRARRRVQGEAPAPTEDLPRQREVVDAFFAAAREGDFDALVAVLHP
201 DAILRADGADGSEVRRGAQQIARNAMRFAHLAPHVRPVLVNGGPGIVVAP
251 EGKVVTVMAFTVVDGRIAAIDAIADPGRLSYVEL

Name Aliases LCA Taxa Group Subgroup
ECFp19718
  • hypothetical protein
  • A3IC_RS0140290
Streptomyces scabrisporus DSM 41855 ECF41 ECF41s2

>ECFp19718 ECF41 ECF41s2 Streptomyces scabrisporus DSM 41855

1 MDDNEFLAGRFEEHRSHLRAVAYRMLGSLNEADDAVQETWIRLSRSDVSE
51 IDNLGGWLTTVVARVSLNMLRSRRTRREDPLDAHVPDPVVDPGEGTDPEH
101 EAVLADSVGLALLVVLETLAPAERLAFVLHDMFALPFDEIATIVDRTPTA
151 TRQLASRARRRVQGSPGDPDVDPTRQREVVDAFLAASRDGDFQALLALLD
201 PDVVARADGAAARAGATTEARGATAVAEIFAGRARGARTALIDGIVGAVW
251 APGGKPRVIFGFTVVDGLIVGIDLLSDPDHLRETEVTIVG

Name Aliases LCA Taxa Group Subgroup
ECFp19733
  • DNA-directed RNA polymerase sigma-70 factor
  • OQ00_RS10445
Pseudonocardia autotrophica ECF41 ECF41s2

>ECFp19733 ECF41 ECF41s2 Pseudonocardia autotrophica

1 MDPVADFEEHRPYLRQVAYRVLGSLSEADDAVQEAWIRLHRSDPAHVDNP
51 RAWLTTVVARVALNQLRARQTRREQPFPDHLPDPIVRRDDAADPEYGAEL
101 ADSVGLALLVVLETLAPDERLAFVLHDMFGLPFDEIAPLVERTPAAARQL
151 ASRARRRVRGAEPALRPDRGARREVVDAFLAAAREGDIEGLVAVLDPDVV
201 LRADTGDGLRAVHGARAVAGQAAAYRSEDQVRHPVLVNGEPGVLGTLDGR
251 PVALLAFTVVDGRITEIDILADRGRLAGLDPELLR

Name Aliases LCA Taxa Group Subgroup
ECFp19761
Rhizobium sp. Root708 ECF41 ECF41s2

>ECFp19761 ECF41 ECF41s2 Rhizobium sp. Root708

1 MNEKNWLAGEFEANRAHLGAVAFRMLGSRTEADDAVQEAWLRLGRSDAEA
51 IDNVGGWLTTVVARICLDMLRSRKTRREDPFDPLAHEHVVDTSRTTDPER
101 EVALADSVGLALLIVLERLVPAERIAFVLHDMFDLPFDDIAPIINRSSMA
151 TRQLASRARRRVQGRTDAPEADTSRKRQIVNAFLAASRLGDIGALLSILD
201 PQVVFVPDVTAMRYGAESELYGAAAVADTFKGRAQGAQPALIDGEFGLVV
251 VVGGRLHVVLLLTFDGEKIAGIDAVADPEYLGKLRYELI

Name Aliases LCA Taxa Group Subgroup
ECFp19764
  • DNA-directed RNA polymerase sigma-70 factor
  • ON33_RS31195
Nocardia niigatensis NBRC 100131 ECF41 ECF41s2

>ECFp19764 ECF41 ECF41s2 Nocardia niigatensis NBRC 100131

1 MDEAQWLAECFEKERPRLRAVAYRMLGSVDQAEDAVQDAWLRLSRTGSAE
51 IDNLGGWLTTVVARECLHQLRSRRQRREVPFDTQLPELLVSDAGLDPEQE
101 MMLADAVGVALLMVLERLAPAERVAFVLHDMFDLPFADIADIVGRTPAAT
151 RQLASRARRRVNGAEVPRPDPDLARQRKVVDAFYAAARDADLDALLQVLD
201 PDIVLRTDYGAGRPASVVSGPAAVAEQVRVPRGGRLRHLVVNGAIGALSI
251 RDEQPYAVMVFTVADDRIVRIDVIRDTDRVRRVAAEVDSRPD

>ECFp19793 ECF41 ECF41s2 Streptomyces sp. FxanaD5

1 MGEGEEQLARSFEEHRGHLKAVAYRMLGSLAEAEDAVQEAWLRLGRMEPG
51 EIDNLGGWLTTVTGRICLDLLRSRTARREQPMDDTFVPDPVIRPLSRVDP
101 EQEALEADSVGIALLVVMENLDPDERLAFVLHDMFAVPFDNIAAVLERTP
151 AATRQLASRARRRVRDTAPPSDPDTARQREALDAFRAAARTGDFEALLAV
201 LHPDVVLRADAGALVQGVAASKRLQGARRVAESAMLFSRYNATARMVLVN
251 GAPGLVGVADGRVGSVLTATVHEGRITALYVLADPERLRDLTLPDEEDAA
301 HA

Name Aliases LCA Taxa Group Subgroup
ECFp19812
Streptomyces canus ECF41 ECF41s2

>ECFp19812 ECF41 ECF41s2 Streptomyces canus

1 MAGERGVRGERDVRDMRQEQRLAERFEEHRGQLKAVAYRMLGSLAEAEDA
51 VQEAWLRLDRSDGDGIDNLGAWLTTVTGRICLDLLRSRTARREEPMTEGF
101 DTFVPDPVLRALPQADPEAEALHTDSVGIALLVVLETLEPAERLAFVLHD
151 MFAVPFDAIAPVVERTPAATRQLASRARRRVREATPAAEPDLGRQRRVVE
201 AFLAASRAGDFEALVSVLHPDVVLRADAGALARGVAASKVVRGARTVATG
251 AFHFRHLAPLARVVLVNGAVGTVAVSEGRPRSVTYVTVADGLITGLYILS
301 DPERLARLDLSGLEG

>ECFp19818 ECF41 ECF41s2 Terrabacter sp. Root181

1 MDDDTREQWLARDFEQQRPRLRAVAYRVLGSAADADDAVQEAWLRLSRSD
51 TTEVTNLAGWLTTVVGRISLDMLRSRSSRREDSWDAGLAELVAGGAVRTA
101 PTQPTRPAPDPASEVELADSIGLALLVVLDTLAPAERLAFVLHDLFGMPF
151 EQIADILDRSPAATRQLASRARRRVRAADADAAAPARTRQREVVTAFLTA
201 ARGGDFTALLEMLDPDVVLTSDEAAVAMGSPEVLRGPEAVAQRFNGGARS
251 ARLAAFDGGIGAVWTLRGEAMVAFRFTVDDDRDIVTGIEMVADRARLDAM
301 EIWFLTS

Name Aliases LCA Taxa Group Subgroup
ECFp19849
  • RNA polymerase sigma factor SigJ
  • ERS450000_03734
Nocardia farcinica ECF41 ECF41s2

>ECFp19849 ECF41 ECF41s2 Nocardia farcinica

1 MHDEQYLADRFEEHRTHLRAVAYRMLGSLSDADDAVQEAWLRLARTDTGD
51 VDNLGGWLTTVVGRVCLDMLRARKTRHEEPLETEHLPDPVILGENTSDPE
101 HEALLADSVGLALLVVLESLSPAERLAFVLHDMFAMPYEQIAPIVDRTPQ
151 TAKKLASQARRRVQGMTPAPDPDLPRQRRVVDAFLTAARGGDFDELLQLL
201 DPDVVLRADAGEAMRVIRGAAAVAGQAETFQRMATLCTVHPAVVNGGTGL
251 VNTVEGAPFSVIGFTVANDRITAIDILSDPARLARLDLTAVLN

>ECFp19833 ECF41 ECF41s2 Streptomyces sp. FxanaC1

1 MNDHEWLAERFEENRRHLRAVAYRMLGSLSEADDAVQEAWLRLSRSGADD
51 VENLGGWLTTVVGRVCLDQLRMRKARREDSLEVHVPEPLVSRPDALDPEQ
101 EALLADSVGLALLVVLETLTPVERLAFVLHDMFAVPFDEVAPLVDRTPAA
151 ARQLASRARRRVQGAAPAPDTDLARQREVVDAFLAASRGGDFEGLLAVLD
201 PDVVLRADAGGTPEGLSKLVRGARAVVEQALTFSRFAPFARPALVNGTPG
251 LVTAQGGQPLSVLGFTIAHGKIVEINILADLARLSRLDLSILDD

>ECFp19860 ECF41 ECF41s2 Streptomyces chattanoogensis

1 MDEFGKQTEDGYGNRPRSGNQWLAERFEQHRGHLRAVAYRMLGSLTEADD
51 AVQESWLRLSRSGADGVENLGGWLTTVVGRVCLDMLRTRKALREDSLDTH
101 VPEPVISREEGIDPEQEVLLADSVGLALLVVLETLAPAERLAFVLHDMFA
151 VPFDDIAPIVERTPAATRQLASRARRRVQGTAAPEADLPRQREVVHAFLA
201 ASRNGDFDALLAVLDPDVLLRADGGSVAPNLSKVVRGARAVVEQALLFSR
251 VALTARPVLVNGAPGVVAVQQGRAFSVMAFTVADGRIVEINILADPERLG
301 SVDVTAL

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more