ECF proteins of ECF subgroup ECF41s2

Displaying ECF 1061 - 1080 of 1206 in total
Name Aliases LCA Taxa Group Subgroup
ECFp19109
Streptomyces rubidus ECF41 ECF41s2

>ECFp19109 ECF41 ECF41s2 Streptomyces rubidus

1 MSDLLTEEFERHRGQLRAVGYRMLGSLSEADDAVQEAWLRLNRTDAAAIH
51 NLGGWLTTVTARVCLDMLRSRTSRREEPLDTHVPDPVVTGVEGADPEQQA
101 LLADSVGMALLVVLDTLAPAERLAFVLHDMFAVPFDDIAPIVDRTPAAAR
151 QLASRARRRVQGVDLDPETDVSRQREVVDAFVSASRGGDFEALLAVLDPD
201 VVLRADVGAALVGVSHEIRGAAKVAGQALLFRGGSVAEALDSRTVLVNGT
251 VGRLNRLDGKAVSLLAFTVRGGRITRIDILGDPDRLATLDLPPV

Name Aliases LCA Taxa Group Subgroup
ECFp19153
  • DNA-directed RNA polymerase sigma-70 factor
  • P696_RS0103190
Actinomadura oligospora ATCC 43269 ECF41 ECF41s2

>ECFp19153 ECF41 ECF41s2 Actinomadura oligospora ATCC 43269

1 MDDNEWLAERFEHRPRLRAVAYRMLGSLAEADDAVQDAWLRLSRSDAEQI
51 DNLGGWLTTVVARECLHMLRSRRRRREEPFATHLPDLVAVPAGDLGPEQE
101 ALLADSVSLALLLVLDRLTPAERLAFVLHDMFELPFGEIAGIAGRAPAAA
151 RQLASRARRRVNGAQVPSPDPDPARQRQVVGAFYAAAWTGDFDALVQVLD
201 PDVVLRTDFGAARPPTIVRGAPAVARRSRAPRGGELRPALVNGTAGTLIT
251 RDGRPFSVMAFTVAGDKIVRIDVIRDPDRVHRLASAVLHQAE

Name Aliases LCA Taxa Group Subgroup
ECFp19161
  • DNA-directed RNA polymerase sigma-70 factor
  • IF61_RS0130830
Streptomyces roseoverticillatus ECF41 ECF41s2

>ECFp19161 ECF41 ECF41s2 Streptomyces roseoverticillatus

1 MNENEFLAERFETHRSRLRAVAYRMLGSLSEADDAVQEAWLRLDRSGADG
51 VANLGGWLTTVVGRVCLDILRSRASRAEEPLDFRVPDPVVSRGAEEVDPE
101 HEALLADSVGLALLVVLDTLDPAERLAFVLHDMFGMPFDEIAPMVGRTTT
151 AARQLASRARRRVRGAAPEPETDLARQWKVVDAFMAASRAGDFDALLAVL
201 DPDVVLRADAGAGGARGSQEVRGAREVAGQAMLFRSPALFARRALVNGAA
251 GVVTALEGRLLSVLGFTIADGRIVEIDILADPERLGRLDVRTEF

>ECFp1915 ECF41 ECF41s2 Nocardia farcinica IFM 10152

1 MHDEQYLADRFEEHRTHLRAVAYRMLGSLSDADDAVQEAWLRLARTETGD
51 VDNLGGWLTTVVGRVCLDMLRARKTRHEEPLETEHLPDPVILGENTSDPE
101 HEALLADSVGLALLVVLESLSPAERLAFVLHDMFAMPYEQIAPIVDRTPQ
151 TAKKLASQARRRVQGLTPAPDPDLPRQRRVVDAFLTAARGGDFDELLQLL
201 DPDVVLRADAGEAMRVIRGAAAVAGQAETFQRMATLCTVHPAVVNGGTGL
251 VNTVEGAPFSVIGFTVANDRITAIDILSDPTRLARLDLTAVLN

>ECFp19205 ECF41 ECF41s2 Rhodococcus

1 MNDNEVLAHRFEENRTHLSAVAYRMLGSISEAEDAVQEGWLRLSRAETSD
51 VENLPGWLTTVVARVCLDMLRSRKTRREEPLDVHVPDPIVSELDGADPEH
101 EAVLGDSVGLALLVVLDTLTPAERLAFVLHDMFALSFDEIAAIAGRTPAA
151 ARQLASRARRRVQGSGPAPDTDLARQREIVEAFMAASRGGRFDDLLALLD
201 PDIVLRADRGAEGSDVVRGARAVSEQALTFSRFAPFARLALVNGAAGVVT
251 APGGKTFSVMAFTVSGGKIARIDILADPHRLQRLRLAHAGD

>ECFp19224 ECF41 ECF41s2 Saccharothrix sp. NRRL B-16348

1 MIDDELLATRFEADRSHLKAVAYRVLGSMSEADDAVQEAWVRLQRADTRD
51 VDNLTGWLTTVVGRVCLDMLRSRASRREDPLDVRVPELVVEPADGGDPEH
101 EAVMADSVGTALLVVLGTLAPAERLAFVLHDLFAVPFDDIAPIVGRTPAA
151 TRQLASRARRRVQGAPVPDDLPRQRRVVDAFTAAARDGDFEALLTVLDPD
201 VVLRVDLGALNPDLTAAVRGAAEVAGQALRFRQPAAVSRRVLVNGGMGIL
251 VAADGKPTSLMSFTVSGGRIVAIDVLSDPERLAGLDLSALDLPRRT

Name Aliases LCA Taxa Group Subgroup
ECFp19229
Rhodococcus opacus ECF41 ECF41s2

>ECFp19229 ECF41 ECF41s2 Rhodococcus opacus

1 MNENDVLAQQFEAHRTHLRAVAYRMLGSIGEAEDAVQESWLRLSRTDADT
51 VENLGGWLTTVVARVCLNMLQSRRSRREDPLDAVMPDPIVTRADGSDPEH
101 EAVLADSVGLALLVVLGTLAPAERLAFVLHDMFAVPFDDIAPIVERTPAA
151 ARQLASRARRRLQGAPVPDTDPVRQRAVVDAFLAAARSGDFDALVAVLDP
201 DVVLRADTGALPAGVSTTVRGSETVAGRVLGFARLARFAHPALVNGAAGV
251 VAISDGQLLSVMGVTIRRGKIVEIDILADRERLAGLVVENLD

Name Aliases LCA Taxa Group Subgroup
ECFp1924
  • putative RNA polymerase sigma factor
  • SVEN_3859
Streptomyces venezuelae ATCC 10712 ECF41 ECF41s2

>ECFp1924 ECF41 ECF41s2 Streptomyces venezuelae ATCC 10712

1 MTGRERGDRRVRVDHDHDDLTDAKELLARRFEADRGHLRAVAYRMLGSLS
51 EAEDAVQEAWFKLNRSDVSAVENLSGWLTTVVGRVCLDMLRSRGSRREDP
101 LEYYVPDPVVRVAGATDPEHTAEVTESVGLALLVVLETLGPAERLAFVLH
151 DMFAVSFDEIARIVDRTPAATRQLASRARRRVQDATPAPGPDARRQREIA
201 DAFLAAANGGDFEGLLAVLDPDVVLRADGGRTLAAVSKLVRGAEAVISQA
251 LMYARFRQAALPVVVNGAPAVLSVVDGRPGALMAFTIAGDRIVELQILAD
301 PERLAALGLSEEDLARATY

Name Aliases LCA Taxa Group Subgroup
ECFp19252
  • DNA-directed RNA polymerase sigma-70 factor
  • SIRAN_RS44345
Streptomyces iranensis ECF41 ECF41s2

>ECFp19252 ECF41 ECF41s2 Streptomyces iranensis

1 MDGRKPGNGQRRHPQDGLAERFETHRGRLRAVAYRMLGSLSEADDAVQET
51 WLRLSRADAEAVGNLSGWLRTVISRICLDMLRSRTARREEPVGQELPEMA
101 RETGDGGGPEDEAVLADSVGRALLVVLDTLGPAERIAFVLHDVFAVPFDR
151 IAPIVERSPVAAKKLASRARQKVRGIAAVPRAELDRQRRTVDAFLAAARG
201 GDMEALLAVLDPDVVRRADRAALPEGMPTVARGARAVAKETAGFAPRARF
251 AEPALVNGSVGVVVAPHGRLLLALTVTVEDGRIAAYEVIADPARLSRLEL
301 GLLDDVGPHVASAHE

Name Aliases LCA Taxa Group Subgroup
ECFp19286
  • DNA-directed RNA polymerase sigma-70 factor
  • IO39_RS37070
Nonomuraea candida ECF41 ECF41s2

>ECFp19286 ECF41 ECF41s2 Nonomuraea candida

1 MDEHHWLAERFTEHRSHLRAVAFRLLGSLSEADDALQDAWLRASRADVGQ
51 VHNIAGWLTTVVARVCLNMLRSRGNRREEPLDIQAADPLLGPASAGNPEQ
101 EVEMADSVGVALLVVLDTLSPAERLAFVLHDLFAVPFEEIAPMLERSPEA
151 TRQLASRARRRVKGAAPAPQADLTRRREIVEAFLAATRGRDFQALITLLH
201 PEVVLRADKAVMLTAEPVTVHGAEPVAKGAMAAMQRAQFTGLALLDGAVG
251 LVMAPHGRLRVALTFTIVDGLVTAIDVIAESDRLDRLDLAVLD

Name Aliases LCA Taxa Group Subgroup
ECFp19278
  • RNA polymerase subunit sigma-70
  • N912_RS55615
Pseudonocardia acaciae DSM 45401 ECF41 ECF41s2

>ECFp19278 ECF41 ECF41s2 Pseudonocardia acaciae DSM 45401

1 MDDHDWLARRFEENRGHLRAVALRMLGSASEADDAVQEAWLRLSRSDTGD
51 VENLGGWLTTVVARVCLNMLRSRTSRPEQPWDERVTGPVEADGDAVDPER
101 EAVLADSVGSALLVVLDTLAPAERLAFVLHDMFAVPFDEIAPIVGRSPAA
151 ARQLASRARRRVQTAQRVTDTDIARQRVIVDAFLAASRDGDFEALLAVLD
201 PDVVLRADAVATSWGAPGTVRGAVAVAEQFRGRARGARTALVDGAVGAAW
251 TPGGRPRVIFDITIRRGKIVEIELLADPDRLGRLDLAVLDRAGARSDAEH
301 LDDQPGDLPS

>ECFp19308 ECF41 ECF41s2 Streptomyces sp. Root431

1 MTGREGGDGRVNAELDHGKEALARRFEADRGHLRAVAYRMLGSLSEAEDA
51 VQEAWFKLSRSDVSAVENLSGWLTTVVGRVCLDMLRSRGSRREDPLEYYV
101 PDPVVRVHDATDPEHTAELTESVGLALLVVLETLSPAERLAFVLHDMFAV
151 SFDEIARIVDRTPAATRQLASRARRRVQDASPAAGPDARRQREIADAFLA
201 AANGGDFEGLLAVLDPDVVLRADGGKVLAAASKVVRGAEAVISQALMYAK
251 FRQAALPVVVNGSPAFVAVVDGRPTVLMAFTIAEDRIVGLQILADPERLA
301 TLGLTDEDLARATF

Name Aliases LCA Taxa Group Subgroup
ECFp19314
  • RNA polymerase subunit sigma-70
  • CQ14_15430
  • ... more
Bradyrhizobium lablabi ECF41 ECF41s2

>ECFp19314 ECF41 ECF41s2 Bradyrhizobium lablabi

1 MDEKKFLAEKFEANRARLRAVAYRMLGSTAEVDDAVQETWLRLSRSDTSA
51 VENLGGWLTTVVARVCLDMLRSRKARREEPMGAHVPEPVADDAQGRDAEM
101 ADSVGAALLVVLETLAPAERLAFVLHDMFAVPFEEIAPIVGRTPAAARQL
151 ASRARRRVQGTPPPDADFSRQKNIVDAFLKASRDGDFEGLLAVLDPDVVV
201 RADQAAQRLGSLAEIRGAAAVAEFFKGRAQAAKPALVDGSLALAVMLGGQ
251 LRVVVRLTISGERISAIEAVADAKRIDEFDVTLLT

Name Aliases LCA Taxa Group Subgroup
ECFp19312
Rhizobium sp. AC27/96 ECF41 ECF41s2

>ECFp19312 ECF41 ECF41s2 Rhizobium sp. AC27/96

1 MDERNWQAEKFEANRPHLRAVGYRMLGSRTEAEDAVQEAWLRLLKTDMSE
51 IENLGGWLTTVTARICLDWLRARKSRREEPLTAHIPEPAVTHDAGNGTDP
101 EQDALLADSVGLALLVVLQRLNPAERLAFVLHDMFDMPFDDIAPIVERSV
151 VATRQLASRARRRVQETPVATEADLTRQWHVVDAFLTASRGGDMQALLAV
201 LDPKIVFRPDAVAALMGSVSDIHGQAAVAEAFRGRAQAARPAVIDGSIGA
251 VVVLGGQLRIALRFTIAADGMITAVDALADPEELRRLDVMMIEP

>ECFp19326 ECF41 ECF41s2 Caulobacter sp. Root1472

1 MDEKNFLAVQFEASRAHLQRVAFRMLGSREAAEDAVQEAWFKVSRADTAD
51 VDNLGGWLTTVVSRVCLDMLRSRRARREDALGPAVLEPAIGEDDSAYPER
101 ETLLADQVGMALMVVLQTLPPAERVAFVLHDMFDLPFDDIATIVDRSPEA
151 ARQLASRARRRVGGGAAAVRPDIERQRVVVQAFLRAARGGDMQGLLAVLA
201 PDVVFHADAAAQKSGSRPELRGAEAVAANFHGRAQAARPALVDGVLGLAV
251 AIDDGPVFVVLRLSLRSGRITAIEAVADPERLSGFEIEVLDELPIAEA

Name Aliases LCA Taxa Group Subgroup
ECFp19347
  • DNA-directed RNA polymerase sigma-70 factor
  • N912_RS0112200
Pseudonocardia acaciae DSM 45401 ECF41 ECF41s2

>ECFp19347 ECF41 ECF41s2 Pseudonocardia acaciae DSM 45401

1 MDDGDWLATRFEENRGHLRAVAYRMLGSLTEADDAVQEAWLRLSRSDSGA
51 IHNLGGWLTTTVARVCLDMLRSRSSRREEPLGPHVPDPVVSRDTGTDPEH
101 EALLADSVGLAMLVVLETLAPAERLAFVLHDTFGVPFEQIAPLVGRSPAA
151 ARQLASRARRRVRASAPVPDPDLDRQREVVDAFLVAARDGDFDALVAVLD
201 PDVVLRADQGALAVGAPAEVRGAAAVARQAITYSRLGAPGSRVRPALVNG
251 AAGLVASRDGRPFSVLGFTVSAGKVVELDILADPERLARLDLAVLDD

Name Aliases LCA Taxa Group Subgroup
ECFp19351
Labilithrix luteola ECF41 ECF41s2

>ECFp19351 ECF41 ECF41s2 Labilithrix luteola

1 MNEIDFEEYRAHLRGVAYRMLGSLTEADDAVQEAWLRLNRSDVRDVSNLG
51 GWLTTVVARVCLDMLRSRESRAEEPVPAAMAQQPAPSDPESEAQLADSVG
101 IALLLVLDTLEPVERLAFVLHDVFAVPFDEIASIVGRSPDAARQLASRAR
151 RRIQGVPTQAIPDSGLVNQRKVVSTFLAALRKGDMQSLLAVLDPDVVVRF
201 EQADGSRQELRGAMNWAKGATAFSYGFRFADAALVDGSPGLVMALHGKLF
251 RAVRFTFGGDGRIVGADVIAHRARLDALDLGVLA

Name Aliases LCA Taxa Group Subgroup
ECFp1934
  • DNA-directed RNA polymerase sigma-70 factor
  • putative RNA polymerase sigma factor protein
  • ... more
Oligotropha carboxidovorans ECF41 ECF41s2

>ECFp1934 ECF41 ECF41s2 Oligotropha carboxidovorans

1 MSENNFLAERFEANRVHLRAVAYRMLGSRSEAEDAVQEAWLRLGRTDSED
51 IKNLGGWLTTVVARICLDMLRARKSRREEQLSPLTPEPAADNENGEEEIA
101 DSVGAALLIVLDTLSPAERLAFVLHDMFAVPFEEIAPIVGREPAAARQLA
151 SRARRRVQGASAKSETEMPVADLSRQREVVDAFLAASKLGDFEALLTVLD
201 PEVVFRADATAVKMGGPAELRGAEAVANTFKGRAQAAQPAVVDGAMAVAV
251 VFGGRLRIVLELRIEGDRITGIHAIADPDRIKAFDVAILDT

>ECFp19368 ECF41 ECF41s2 Rhizobium sullae WSM1592

1 MTDERKKFLADEFEASRAHLKTVAYRMLGSRAEAEDAVQEAWLRLGRSEV
51 SEIGNLGGWLTTVVARICLDMLRSRKSRREESLDPPVHEKIADMATFADP
101 EREIVLADSVGAALLVVLEQLAPAERVAFVLHDMFDLPFDEIAPIIGRTS
151 DATRQLASRARRRVQGKTDVSETGIEHKKEVVRAFLAASRNGNFQALLAV
201 LHPDVVFAPDAAAARFGDAGELRGAQAVATTFKGRARGALPAFVDGGFGF
251 IVRIDDQLRIIVKIGFDGEKIAKIEAIADPGHLEQIEYRLFDQ

>ECFp19378 ECF41 ECF41s2 Mycobacterium sp. ACS1612

1 MPAEPFEEHRAHLRAVAYRMLGSLTEADDAVQEAWLRYERTDVSEVRNLR
51 GWLTTVVAHICLDMLRARSARAEEPLDEVPPVAADSVDPEAEAVLADSIG
101 VALLVILQTLSPAERLAFVLHDMFDLPFAEIAPIVGRTESTAAQLASRAR
151 RRVRGKSPEAATDLASQRRLVDAFYAAARDGDFDALLGVLDSDVVLRVDA
201 AAAGTPTTFRGARTVAANAQAFSANARFAQPALVDDAVGIVVAPKGKLAL
251 VLRFTVVGERITEIDIAADPQRLGRFRLAVLD

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more