ECF proteins of ECF subgroup ECF41s2

Displaying ECF 1041 - 1060 of 1206 in total

>ECFp18838 ECF41 ECF41s2 Streptomyces olivochromogenes

1 MDDDELLEHLADRFQEHRGRLRAVAYRMLGSLSEADDAVQEVWLKLGRTD
51 VGEIRNLAGWLTTVVGRVCLDLLRSRAARREEPLDTYVPDPLVSPLERID
101 PEQEVLLADSVGLALLVVLETLEPAERLAFVLHDMFAVPFDDIAPVVGRS
151 SAATRQLASRARRRVRGAAAPEPELDPARQKLVLDAFLAASRAGDFEALV
201 SVLHPDVVLRVDSGVLVGGAAASKVVHGATGVAQQALMFRQFAEFSRLVL
251 VNGAIGVVTAPEGRPLSVMAVTITDGRVIEMYILADPARLSDLALPDLAG

>ECFp18835 ECF41 ECF41s2 Streptomyces sp. AcH 505

1 MDERDELAELFEAERGKLRAVAYRMLGSVTEADDAVQETWLRLGRVDAGE
51 LDNLPGWLRTVVTRICLDVLRSRRARPEYVTGQPLDEVPDPAPAGRPEDE
101 ALLADSVSRALLVVLGTLAPAERVAFVLHDMFAVPFDQIAPIVERTPVAT
151 KKLASRARHKVRGVPAAPPAELARHRQVISAFLTAARAGDLPAVLAVLAP
201 DVVRTADLVAVPPGGSPVARGAREVAEGTVVLADRSKLAELALVDGAVGA
251 VVAPGGRLLFALTFTVEGDRIAAYDVIADPARLRELDLAVLG

>ECFp18855 ECF41 ECF41s2 Bradyrhizobium japonicum 22

1 MTEQNLLTEQFEASRDHLRAVAYRMLGSRAEVDDAVQEAWLRVSRYDMSD
51 IANLRGWLTTVVARICLDMLRARKSRKEEPMGPDVPEPADETPLREAEMA
101 DAVGAALLVVLETLQPAERLAFVLHDMFAVPFEEIAPIVGRSVEASRQLA
151 SRARRRVQGAPVPETDLPRQRGIVDAFLKASREGNFEGLLALLDPDVVFR
201 ADEAAVRLGTLPEIRGADAVAQLYKGRARAARTALVDGEIGVAVVLGGQL
251 RIALRVTFRNDRIAGIEALADAERLATLEVEVLES

Name Aliases LCA Taxa Group Subgroup
ECFp18909
  • DNA-directed RNA polymerase sigma-70 factor
  • ON44_RS43320
Nocardia vinacea NBRC 16497 ECF41 ECF41s2

>ECFp18909 ECF41 ECF41s2 Nocardia vinacea NBRC 16497

1 MHAQELLARRFETHRDHLHAVAYRMLGSATEADDAVQEAWLRLDRADTSD
51 VENLAGWLTTVVSRICLDMLRSRTARREDPIDRIAELGDAADDCDPESEA
101 VLIDSVGRALLVVLDTLGPDERVAFVLHDMFAIPFDQIAPIVGRTSAATK
151 KLASRARARAHGDATASTAELAQQRHVVDAFLAAARSGDLDALLAVLAPD
201 VVRTADPAALPSGMAPVARGAQAVARETVILRRRSRVAALALVDGAVGII
251 VAPRGKLLLALAVTVADHRIAGYEVIADPARLRQLDLAVLPEFP

Name Aliases LCA Taxa Group Subgroup
ECFp18916
  • RNA polymerase sigma factor
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Streptomyces viridochromogenes DSM 40736 ECF41 ECF41s2

>ECFp18916 ECF41 ECF41s2 Streptomyces viridochromogenes DSM 40736

1 MTGETMTGSGSEELAERFEGYRGHLKAVAYRMLGSLTEAEDAVQEAWLRL
51 SRTDPDDIQNLGGWLTTVTGRVCLDLLRSRTARREEPVGGTHDTYDTFVP
101 DPVLRPLSHLDPAEEVLQADSVGLALLVVLENLAPDERLAFVLHDMFAVP
151 FDDIAPIVERSPAATRQLASRARRRVRGATPSTEPDLGRQKEVLDAFLAA
201 SRAGDFEALLALLHPDVVLRADSGELVRGAAVSKVVQGAKSVAEQALMFA
251 RFAQSAELVLVNDTVGMVNAPEGRVQSVMAVTITDGRITGMYILADPERL
301 ERLEAPGPTGPDTRR

>ECFp18923 ECF41 ECF41s2 Streptomyces sp. NBRC 110028

1 MDEQDRLAARFEAHRSHLRAVAYRMLGSLSEADDAVQETWLRLSRSDADR
51 VENLPAWLHTVVSRLCLDMLRSRSSRREEPIERQPAHQVRDDGGTGGGAD
101 PEGEAVLVDAVGRALLVVLDTLAPAERVAFVLHDAFAVPFDQIAPVVERS
151 PETAKKLASRARRKVRGTPAVSAAGLAAQRRVVDAFLAAARDGDLEALLA
201 VLAPDVVRRADRAALPAGVPTTSRGARAVAEETTVLGRRARFAEPALVNG
251 SVGVVVAPHGRLLLALTFTVEDERITAYEVIADPARLGGLELAVLDG

>ECFp18983 ECF41 ECF41s2 Streptomyces lavenduligriseus

1 MTTDNDFLAERFEAYRGHLGAVAYRMLGSAAEAEDAVQEAWVRLSRSDTG
51 EVTNLGGWLTTVVGRVCLDMLRSRRTRGEEPLESRLPAPSEEPDPAQRAL
101 LADSVGLALLVVLDTLSPAERLAFVLHDMFGVPFEEIAGILGRTPASARQ
151 LASRARRRVRGVEAPEADLARQRRVVDAFLAAARDGDFEGLLAVLDPDVV
201 ARSESGVNSGAARVAAGAASFAHLARLARPALIDGATGLALFADGRVTQV
251 LAFTFIADRITEIDIITAPSRLAELTVEEA

>ECFp18930 ECF41 ECF41s2 Cellulomonas sp. Leaf395

1 MSGSPAQDAVAGAFEEQRPRLVAVAYRMLGSRVDAEDAVQEAWLRLARQD
51 ATSIDNLAGWLTTVVGRVCIDVLRSRATRSEASYDDQLPHLVVTEADGAS
101 PEEEALLAESVGLALLVVLDSLRPAERLAFVLHDMFAVPFDDIGEIIGRS
151 PDATNMLASRARREVQDTQRPPDERRRERAVVDAFLTAARLGDFEGLVQL
201 LDPAVTWRTVTARGVIVRHGPTEVATRMQRAARAKATARPVLVNGDPGIV
251 AYSVDGEPLGVMGCTVVDGRIVGILSTTDPDRLAAMDLPASPAGRQA

Name Aliases LCA Taxa Group Subgroup
ECFp18980
  • hypothetical protein
  • B072_RS0121345
Streptomyces sp. HmicA12 ECF41 ECF41s2

>ECFp18980 ECF41 ECF41s2 Streptomyces sp. HmicA12

1 MTTQADLAVRFEAERGRLRSVAYRMLGSLNEAEDAVQEGWLRLQRADSAE
51 VRNLSGWLTTVVGRICLDMLRARTTRREEPFETDTGEEFRLPDPVVRPVD
101 PVHEAELADSVGLALLVVLDTLAPAERLAFVLHDMFAVPFEELAPIVERT
151 PAATRQLASRARRRVQGRAPAPDTDLARQREVVDAWLSATRAGDFEALLA
201 LLDPDVLLRVDQGPGTASLLVRGALEVAGQAATYGRMAPVTFPAFVGDGM
251 GMVAAPNGKPATVGAFTFRGGRIIAVDIITDPVRVAAITANWS

>ECFp19017 ECF41 ECF41s2 Streptomyces sp. XY511

1 MSGEEMLARRFEEHRPHLRAVAYRMLGSLSEAEDAVQEAWLRLSRSDADA
51 VENLGGWLTTVVGRVCLDMLRSRTTRREDPLHDEDGRVRLPDPVVSRADG
101 LDPEQEVLLADSVGIALMVVLETLPPAERLTFVLHDLFAVPFDEIAPVLG
151 RTAAATRQLASRGRRRVQGVVPAPDPDPARLRAVVDAFLAASRGGDFAAL
201 VDVLDPEVVARSDGGALLPSLVRRGAAEVASQAITFARLAEAARPVLVNG
251 LPGVVALAEGRAMSVMAFTVRDGRIIALDILTDPERLARIDLGAVVDDA

>ECFp19015 ECF41 ECF41s2 Streptomyces

1 MTDNDFLAERFEAYRGHLRAVAYRMLGSAAEAEDAVQEAWFRLSRSDTQA
51 VENLGGWLTTVVGRVCLDLLRSRRSRGEQPLESWRPAPSAEVDPAQDALL
101 ADSVGLALLVVLDTLSPAERLAFVLHDLFGVPFEEIGGILGRSPAATRQL
151 ASRARRRVRGVEAPEADLARQREVVDAFLAAARNGDFDGLLEVLDPEVEA
201 RTEAGVNSGAARVAAAAAGFAHLARVARPVLVDGATGLAVFADGRPERVL
251 AFAFVADRISVIDIITDPARLADLTVEEV

Name Aliases LCA Taxa Group Subgroup
ECFp19003
  • sigma factor
  • O3I_031180
Nocardia brasiliensis ATCC 700358 ECF41 ECF41s2

>ECFp19003 ECF41 ECF41s2 Nocardia brasiliensis ATCC 700358

1 MDEHLADRFEAHRAHLTAVAYRMLGSLTEADDAVQEAWLRLARVDPAEIS
51 NLGGWLTTAVSRVCLDMLRSRRIRREDSFEEQLPDPVVRLDDGADPEQQA
101 VLSDSVGLALLVVLDSLNPAERLAFVLHDMFALPFDQIGPILGKSSAAAK
151 TIASRARRRVQAGAPRLDPDLPRQRRAVAAFLSAAREGSFDALLSLLDPD
201 VVLRADSGTGGLQIIRGASTVAGLLDTFRTFANRYEVAPAIVNGVAGLLS
251 TVDGAPKSVLAFTVANDRITAIDLIADPERLATLPLPTTH

>ECFp19016 ECF41 ECF41s2 Streptomyces sp. NRRL WC-3795

1 MDEREWLAEQFEGARGHLRAVAYRMLGSLTEADDAVQEAWLRLSRAYDSD
51 IENLRGWLTTVVGRVCLDMLKSRRVRREDPFESVVHVPDYVHEEEGDPEQ
101 RALLADAVGLALLVVLEALDPAERLAFVLHDMFGVPFDEIAPIVERTPAA
151 ARQLASRARRRVRGGTPVSDPDLAKRREVVDAFLSAARGGDFDALLNVLD
201 PGVVARSDGRFGVRGAVAVASTASRFARIAEVAQLALINGAPGVIAAHAG
251 EGFRAMTFDVRDGRIVEIDVITDPQRLLTFDLALLDA

>ECFp19007 ECF41 ECF41s2 Streptomyces hygroscopicus subsp. hygroscopicus

1 MDENHLLAEGFEAHRGHLRAVAYRMLGSLSEADDAVQEAWLRLSRSDTGA
51 VENLGGWLTTVVGRVCLDMLRSRTARREEPLGVRIPDPVVSGESGLGPED
101 QALLADSVGLALLVVLETLAPAERLAFVLHDLFGVPFDEIAPIVDRTPAA
151 ARQLASRARRRVRGAAPAPDPDLARQREVVDAFLAAARGGDMEGLIALLD
201 PDVVLRADYGGAPAAPALREVRGAAAVANQALTFSRLSGSGLLTRPALVN
251 GAVGVVSSREGRPFSVLAFTVVDGRIVAIDILADPERLDGLDLTDLN

Name Aliases LCA Taxa Group Subgroup
ECFp1902
  • RNA polymerase sigma 70
  • putative RNA polymerase ECF-subfamily sigma factor
  • ... more
Frankia ECF41 ECF41s2

>ECFp1902 ECF41 ECF41s2 Frankia

1 MDERERLARRFEEHRGHLRAVAYRMLGSLDEADDAVQEAWLRLSRSDVGA
51 VENLAGWLTTVIARICLNMLRARRNRPEDLAGVHVPDPIIDLAPATGAGQ
101 PEQEALLAEAVGLALITVLDTLAPAERLAFVLHDLFDLSFDEIAPMVGRS
151 PAAARQLASRARRRVRALDTPVPDADHAVQRRVVDAFFAAARGGDVTSLV
201 AVLDPDVVLRADGGAGRPQASAVVRGARDVARRALLFAQPAAVVHPVLVN
251 GTAGVVITIDGRPVSVMGFVVADERIAEIHALVDAGRLARLDLPARLGLP
301 AQLDLAARLGPADGERARSPRSR

Name Aliases LCA Taxa Group Subgroup
ECFp19053
Caulobacter sp. OV484 ECF41 ECF41s2

>ECFp19053 ECF41 ECF41s2 Caulobacter sp. OV484

1 MPEKNYLADKFEADRSRLRGVAYRMLGSLPEAEDAVQEAWLRLSRADTSG
51 VDNLSAWLTTVTSRVCLDMLRSKKSRREDALLEGGPEPSVSGEEAIERET
101 ILADSVGLALLVVLQALSPAERIAFVLHDLFDMPFDEIAPIVERTPDAAR
151 QLASRARRRVRGGEAPLDAAQTAKKSVVDAFLTASRTGDMQGLLAVLDPN
201 VVVRADVFAGGGQTRELRGREKVAAYYDGLAQTARTALVDGEIGAVVAPR
251 GKLYLVLDIKVENGKVVEITAVGDPERLAQLELSVTDL

Name Aliases LCA Taxa Group Subgroup
ECFp19067
  • RNA polymerase subunit sigma-70
  • N688_RS10960
Thermogemmatispora carboxidivorans ECF41 ECF41s2

>ECFp19067 ECF41 ECF41s2 Thermogemmatispora carboxidivorans

1 MNTPNRLAIQFEAERPRLRALAYRMLGSLSEAEDAVQESWLHLSRSDTST
51 ISNLEGWLTTTVARICLNMLRARKSRPEDSLEAKVPDLEAMLGGHLSSDP
101 EQEMELADAIGLALLVVLDRLTPAERLAFVLHDIFAVPFDEIAPLVERSE
151 AATRQLASRARRRVRGGVSVQDAELVAQREVVEAFLTAAREGSFDQLLAV
201 LDPDVTFRIEPQALREGARRELHGSVAAATVIVQHAQLFRSCGMALVNGS
251 VGIVVAPYGKLRAVGILVIREGKIIAFTAITDPVRLQQVHLAILDN

>ECFp19091 ECF41 ECF41s2 Streptomyces

1 MDENEFLAERFEENRTRLKAVAYRMLGSQTEADDAVQEAWIRLSRSDDRR
51 IENLSGWLTTVVGRVCLDMLRSRRSRREEPLETQQSGADAPEPVLGPQSG
101 SDPEHQALVADSVGLALLVVLETLDPAERLAFVLHDMFAVPFDEIGRIVD
151 RTPAAARQLASRARRRVQGVDRVPDPDLARKREVVDAFLAAARGGDFEAL
201 VAVLDPDVVARSDGGAGGVGAPSVVRGAASVARQAIMFAPFAQSSRMALV
251 DGAPAVISIRDGQRFSVMRFTIERGRVVELYVVNDPARLPELDLTVLGD

>ECFp19116 ECF41 ECF41s2 Rhodococcus opacus PD630

1 MNDNDMLAQQFEAHRTHLRAVAYRMLGSIGEAEDAVQESWLRLSRTDAGT
51 VENLGGWLTTVVARVCLNMLQSRRSRREDPLDAAVPDPIVTRADGSDPEH
101 EAVLADSVGLALLVVLGTLTPAERLAFVLHDMFAVPFEDIAPIVERTPAA
151 ARQLASRARRRLQGAPVPDTDPVRQRAVVDAFLAAARNGDFDALVAVLDP
201 DVVLRADTGALPTGASTMVRGSETVAGRVLGFARLARFAHPALVNGAAGV
251 VAISDGQLLSVMGVTIRRGKIVEIDILADRERLAGLVVENLD

>ECFp19118 ECF41 ECF41s2 Streptomyces sp. HGB0020

1 MNENSIPAGDGARKAAENEFLARRFESHRSHLRAVAYRMLGSRAEADDAV
51 QEAWFRLNRTDTAAVENLGGWLTTVVGRVCLDMLRSRRSRAEEPLDTTAR
101 ADVAVAGPEQDALLADSVGAALIVVLETLSPAERLAFVLHDLFAVSYEEV
151 GDIVGRSPVAARQLASRARRRVQGADVPDRQQVRQREVVNAFLAAAREGD
201 FEALVELLDPDVIARTDVGVAVGAQAVAKGASRFAHYAFVARDALVGGAT
251 GLAVFLEGRLDRALSFTFVRDRIAVIEIVTDPERVAALDVELL

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more