ECF proteins of ECF subgroup ECF41s2

Displaying ECF 81 - 100 of 1206 in total
Name Aliases LCA Taxa Group Subgroup
ECFp13884
  • DNA-directed RNA polymerase sigma-70 factor
  • BN344_RS11290
Candidatus Blastococcus massiliensis AP3 ECF41 ECF41s2

>ECFp13884 ECF41 ECF41s2 Candidatus Blastococcus massiliensis AP3

1 MSEDAAAPDQLLAEQFEAHRAHLLAVARRVLGAGGEAQDAVQEAWLRLQR
51 TGAGDVENLGGWLTTVVGRVCVDMLRRRAARREEPVGLHAPDADGGSEPE
101 TEAVLADSVGLALLVVLDTLTPPERLAFVLHDLFAVPFGEVAEILDRSPV
151 AVRQLASRARRRVREAAPGAAGPGAAGPGAAGPGDVGRRHEVVRAFLAAA
201 RGGDLAGLLAVLDPEVVLRADAPVAALGGIRRLGGREEVARSFLGKAQAA
251 LPALVDGAPGAVFVPDGRVRAALEFVVTDGRITAVEVVSDPVVVQGLDVV
301 LPGR

Name Aliases LCA Taxa Group Subgroup
ECFp13910
  • ECF subfamily RNA polymerase sigma-24 subunit
  • rpoE
  • ... more
Amycolatopsis methanolica 239 ECF41 ECF41s2

>ECFp13910 ECF41 ECF41s2 Amycolatopsis methanolica 239

1 MTENEWLAERFESHRAHLRAVAYRMLGSLTEADDAVQEAWLKLSRGDADE
51 VRNLGGWLTTVVGRVCLDMLRSRSARREDYPERLPDPVIVPEDGSHPEQQ
101 ALIADSVGLTLLVVLDTLDPAERLAFVLHDMFALPFDEIAPIVDRTPAAA
151 RQLASRARRRIQGSPTVPDGDVTRQREVVDAFFAAARDGNFAALINVLDP
201 DVVLRVEATALPAGASRLAHGAEAVAGQALTFRESGQGGQPVPVLVNGVA
251 GRLILRDGRPQTLFAFTVVNDLIAAIDIISDPERLAELAY

>ECFp13934 ECF41 ECF41s2 Streptomyces sp. CNQ766

1 MTACGERTGALTDEQDWLAERFESDRPRLRAVAYRMLGSVAEADDAVQEA
51 WIRLSRSDLGKVENLGGWVTTIVARVSLNMLKSRKSRSELLVDTTEGDGP
101 RDDMPPDDPEEEAVIADSIGLALLVVLDTLTPAERLAFVLHDMFAVPFEE
151 IATIVDRSPAAARQLASRARRRVRQSTPTERRGESFGVYHGGRSFAPGKS
201 DLATAFLAASREGNFEALLAMLDPDIVLRTDSVAVRMSLEAGMRGMQPIS
251 DVSEIRGADAVTRVFAGRTWNPTPAWIDGAAGLVWLVHGKPHVAFCFATE
301 NGRITAIDIKADLSGLGIDFG

Name Aliases LCA Taxa Group Subgroup
ECFp14007
Micromonospora sp. II ECF41 ECF41s2

>ECFp14007 ECF41 ECF41s2 Micromonospora sp. II

1 MDHGLAERFERERPRLRAVAYRLLGSLTDAEDAVQETWLRLARTDPASVD
51 NLDAWLTTVVARVSLNALRSRAARREDPLDVRLPDPVVDADDPAHAAVLA
101 DSVGLALLVVLDTLSPAERLAFVLHDMFGVPFDEIGPLVDRSPAAARQLA
151 SRARRRVRGQAPTPDPDLTRQRAVVDAFLAAARDGDLDALIAVLHPDVVL
201 RSDAGTARARHTVVLTGATTVAAQATTFGRLFPHTRPVLVNGAAGVLVSA
251 GDRPLSVMAFTVTGGRIAAVDVIADPRRLAALGLTG

>ECFp14018 ECF41 ECF41s2 Streptomyces antibioticus

1 MTDTGNSNDNDFLARRFETHRPHLSAVAHRMLGSAAEAEDAVQEAWFRLN
51 RTGAEDIDNLGGWLTTVVGRVCLDMLRTRTSRAEQPLESHAPVPDTTADP
101 EQDALLADSVGVALLVVLDTLTPAERLAFVLHDLFAVPFEEVGEIVGRTP
151 AAARQLASRARRRVQGAPTPAADEARRRQREVVDAFLAAAREGDFEALVG
201 VLDPDVVARSEAGVTTGALAVAKGATSFAALARTALPALVDGRIGIAAVV
251 DGRVERTLAFTFVRDRIAVIDIVTDAARVADSTVELL

>ECFp14100 ECF41 ECF41s2 Rhizobium etli CNPAF512

1 MDEKKWLADEFEANRAHLRAAAFRMLGSRSEAEDAVQEAWLRLNRTDATG
51 IGNLGGWLTTVVARICLDMLRARKSRREEPLEMPMHAAVADPAGDPEREA
101 AFADSVGLALLVVLQTLAPAERVAFVLHDMFDLPFDEIAPIIGRSSAAVR
151 QLASRARRRVQGTDETPDVDLGRKRTIAAAFLTASRNGDLEALIAVLAPD
201 VVFRPDATAARYGIGAMRGATDVAAAFKGRAQAAEMAIVDGELGFVVHID
251 GQIRVAVTLTIDEGKIVAIDAVADPDQLERLDFSILRD

>ECFp14105 ECF41 ECF41s2 Streptomyces

1 MDAPEIPGGRFEEHRTQLRAVAYRMLGSLSEADDAVQECWLRYSRSDTSQ
51 VRNLAGWLTTVVGRICLDMLRSRTGRAEVPLEGVHVPDPVVAPLTGEEAA
101 VRTEEVGLALLVVLDTLSPAERVAFVLHDTFGVPFDEIAPLLDRTPAATR
151 QLASRARRRVRDAGQGGERPDARRQREVVAAFLAAARGGDFDALVGLLDP
201 QVTLRADTGGAGSRLVRGAAEVASQATAFRSAAMHAVPVLVGGEPGLAAV
251 VGGRAVSVMSFALVPDGHGPAGAVRELNILADPRRLARLGVAEVLGAAPA
301 ERGH

>ECFp14292 ECF41 ECF41s2 Rhodococcus aetherivorans

1 MSDGNFSAHPGGAFPAEQFEAHRDHLRAVAFRMLGSASEADDAVQEAWLR
51 LHRSGTDEVANLGGWLTTVVSRVCLDMLRSRGSRREVPLDQPDRPEPRST
101 DPRDVPESAALLADSVGVAMPVVLDTLAPAERLAFVLHDLFAVPFDEIAP
151 IVERSPAATRQLASRARRRIQGATAPRADLMRRRRLVDAFLAASREGRFD
201 DLLALLDPDVVLRADDVAVATARAGAAHGAPALAHELHGPHSVAKVFDGR
251 AQAARTVLVDGMPGAAWAPGGRPRTVFAFTIEDDAIVEIEVVSDPGQLAA
301 LEVTFPDAG

>ECFp14355 ECF41 ECF41s2 Rhizobium sp. WYCCWR10014

1 MDEKKWLTEEFEANRAHLRAAAYRMLGSRSEAEDAVQEAWLRLSRTDTTG
51 VDNLGGWLTTVVARICLDMLRARKNRREEPLEAPVHAGIADPANDPEREA
101 AFADSVGLALLVLLQTLAPAERVAFVLHDMFDLPFDEIAPIIGRSSAATR
151 QLASRARRRVQGVDEAPDGDFGRKRTIAEAFLTASRNGDLEGLIAVLAPD
201 VVFRPDATAARFGTIGKMRGAAHVAEAFKGRAQAAEIAIVDGELGFVVEI
251 KGQLRVVVALTIADDRIAAIDAIADPDHLEQLDYSILRD

>ECFp14451 ECF41 ECF41s2 Actinomadura macra NBRC 14102

1 MDERDFLAERFEAHRGHLKAVAYRMLGSLAEADDAVQEAWLRLSRTDADA
51 VQNLGGWLTTVVGRVCLDMLRSRTSRRETPLDERLPDPVISPVDGVDPEQ
101 RALLADSVGLALLVVLQSLGPAERLAFVLHDTFAVPFEEIAPIVGRSPAA
151 ARQLASRARRRVRGAVPVPERDLTRQRQVVDAFLAAARDGDFEALVTVLD
201 PDVVLRADQGALPDGGWREIRGAEAVAGQALTFRRASFRALPALVNGTAG
251 IVNVTGGRPVSVLSFTIADGRVVAIDILADPDRLDGLDLTILG

>ECFp14468 ECF41 ECF41s2 Streptomyces sp. WM6368

1 MDGNAWLTERFEEHRSHLRAVSYRMLGSLAEADDAVQETWLRLSRSDISE
51 VENLGGWLTTVVSRVCLNMLRSRASRREDSMDAYPTDPAGSREDTVDPEQ
101 EAVMADSVGLALLVVLDRLAPAERLAFVLHDLFAVPFDEIAPMIEKTPAA
151 TRQLASRARRRVKGAPLVPEADLTRRRHVVEAFLAATRGGNFDALVTLLH
201 PDVVLRADTAVVPTPAPILLRGAVTVATSAMAAMQRARATAPALVDGTVG
251 LAMAPLGRLFLVLGFTIEDGLITEIDIVAEPERLGALELAALDV

>ECFp14470 ECF41 ECF41s2 Micromonospora

1 MDLAERFERERPRLRAVAYRLLGSLTDAEDAVQETWLRLSRTDADTVENL
51 DAWLTTVVARVSLNTLRSRAARREDPLDVRLPDPVVDTGADDPAHAAVLA
101 DSVGLALLVVLDTLTSAERLAFVLHDMFGVPFDEIGPLVDRSPAAARQLA
151 SRARRRVRGQAPTPDPDLTRQRAVVDAFLAAARDGDLDALIAVLHPDVVL
201 RSDAGTARARHTVVLTGATTVAAQATTFGRLFPHARPVLVNGAAGVLVTA
251 GDRPLSVMAFTVAGGRIAAVDVIADPRRLAALGLAG

>ECFp14482 ECF41 ECF41s2 Arthrobacter sp. Soil736

1 MDQNELLARGFEAHRGHLRSVAYRMLGSLSEADDAVQESWLRLSRADTSG
51 VENLRGWLTTVVGRVCLDMLRSRTSRREDPLPDDAPLLPGSSAGLARGAA
101 ELAGDRGGSGDPEHQAELADSVGLALLVVLETLSPAERLAFVLHDLFAVP
151 FDEIAVIAGHSPAAVRQLASRARRRVQGAEVQGSAAVHESAEPDAGRARQ
201 RAVVEAFLDASRNGNFDALLALLDPDAVVRVDAAAAGFGAEGADGAQAVA
251 VTFSGRAQAAELALIDGAAGAVWAPGGQPRVVFGFTLEGGRIARIDILAD
301 PAVLSGLELAFVDR

>ECFp14498 ECF41 ECF41s2 Actinobacteria bacterium OV320

1 MTTYTALPPERFEADRPHLRAVAYRMLGSLGEAEDAVQETWLRASRADVG
51 DVDNLSGWLTTVVGRVCLNMLRSRRTHPEVPLDARVSEPAAGTAQGGDPE
101 EEALLADSVGVALLVVLDTLAPAERLAFVLHDLFAVPFDTIAPMIERTPA
151 TTRQLASRARRRVRGGAPAAVADRVRQRRVADAFLAATRGGDFEALLALL
201 HPDVVLTADRFVVPTPEPVTVSGARPVAEGAMAATGRARFTGLALLDGRV
251 GLAMAPHGRLRVVLLFTLAEGAITRIDVVADRERLDGIEVAVLDTVGAGP
301 VGAGPVDTAPVSAED

>ECFp14501 ECF41 ECF41s2 Rhizobium leguminosarum bv. trifolii WSM597

1 MNEKKWLADQFEANRAHLRAAAYRMLGSRSEAEDAVQEAWLRLNRSDTTD
51 VGNLGGWLTTVVARICLDMLRARKTRREEPLEMPVHAAIADPAHDPERDA
101 AFAESVGVALLVVLQTLAPAERVAFVLHDMFDLPFDEIAPIIGRTSAAAR
151 QLASRARRRVQGTDEAPDVDFGRKRTIAEAFLTASRNGDLEALLAVLAPD
201 VVFRPDATAARFGPFGGRRGASEVAELFKGRAQAAEAALVDGEVGFIVRI
251 KGELRVVVTLTIVDGKVTVIDAFADPDYLEHVDYSVLSS

>ECFp14505 ECF41 ECF41s2 Streptomyces sp. CNQ865

1 MTACGERTGALTDEQDWLAERFESDRPRLRAVAYRMLGSVAEADDAVQEA
51 WIRLSRSDLGKVENLGGWVTTIVARVSLNMLKSRKSRSELLVDTTEGDGP
101 RDDMPPDDPEEEAVIADSIGLALLVVLDTLTPAERLAFVLHDMFAVPFEE
151 IATIVDRSPAAARQLASRARRRVRQSTPTERRGESFGVYHGGGSFAPGKS
201 DLATAFLAASREGNFEALLAMLDPDIVLRTDSVAVRMSLEAGMRGMQPIS
251 DVSEIRGADAVTRVFAGRTWNPTPAWIDGAAGLVWLVHGKPHVAFCFATE
301 NGRITAIDIKADLSGLGIDFG

Name Aliases LCA Taxa Group Subgroup
ECFp14745
Caulobacter sp. AP07 ECF41 ECF41s2

>ECFp14745 ECF41 ECF41s2 Caulobacter sp. AP07

1 MSEQNSLAGQFEANRAHLRRVAYRMLGSHGEADDAVQEAWLRLSRSDAAA
51 VANLGGWLTTVVSRVCLDMLRARRSRREDALGPQVPEPAVDEDDADFPGR
101 EMLLADSIGLAMTVVLEALPPAERVAFVLHDLFDLPFEEIAVIVGRTPGA
151 ARQLASRARRRVRGATTSAQTDQVRQRQVVDAFLAASRGGDLSALLAVLD
201 PDVVFRSDAQAVRVGGAEELRGADAVAATFVGRAQAARPALVDGALALAV
251 ERDGRLFVVLRLAVADGRITSIEAVADHERLAGMTVVML

Name Aliases LCA Taxa Group Subgroup
ECFp14765
  • DNA-directed RNA polymerase sigma-70 factor
  • IF55_RS00670
Streptomyces varsoviensis ECF41 ECF41s2

>ECFp14765 ECF41 ECF41s2 Streptomyces varsoviensis

1 MADRFLAGRFEEHRGRLRAVAYRMLGSLAEADDAVQETWLRLHRSDTGEV
51 ANLGGWLTTVVGRVCLDMLRTRASRGERPLDARVPDPVVSGPAGPDPEHQ
101 ALLADSVGLALLVVLETLGPAERLAFVLHDMFAVPFDEIAPMVGRSPAAA
151 RQLASRARRRVRGTETVPDADLARQREVVDAFLAAARGGDFEALVAVLDP
201 EVVLRADAGAGVAAGAAAGGSAVVRGAREVAGRALLFQRAAARQPLPVLV
251 NGAAGIVSVLDGRAAAVLGFTVARGKIVEIDILADPERLRRIDLAPLEG

>ECFp14805 ECF41 ECF41s2 Streptomyces sp. CNT371

1 MDEQKLPEEFPADRSAEVLAERFEAERSRLRAVAYRMLGSAAEADDAVQE
51 TWLRLSRSDADAIGDLTAWLVTVVSRVCLNMLRSRAHRREEPLEHGYADG
101 GTSGAGAAAGTGTGTAPPPRDPEEEALLADSVGVALLVVLDALAPAERLA
151 FVLHDMFAVPFDEIGPMLDRTPAAARQLASRARRRVRGGAPAASAPAEDL
201 RRRRRIVAAFLAATRGGDFEALVSLLHPDVVLRADRTAIPTPEPVEVRGA
251 APVAQGAMAAAGRARFTGPALIDGAVGLVMAPLGRLRLLLSFTVAEGLIT
301 EIDVIADADRLAGVEVGVPAD

Name Aliases LCA Taxa Group Subgroup
ECFp14813
  • RNA polymerase sigma 70
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Sinomonas humi ECF41 ECF41s2

>ECFp14813 ECF41 ECF41s2 Sinomonas humi

1 MDASDLLGRRFEAERGRLRAMAYRMLGSLSEADDAVQDAWVRLSTTDAGA
51 IGNLGGWLTTVVARICLNILRSRETRGEAPLDDSIPELADRRAGSDPEEE
101 AVMADAVGLALLVVLDSLQPAERLAFVLHDMFDVPFANIAPIIGKSTEAT
151 RQLASRARRRVKGSASPSPDAARQLHAVEAYLAAVRSGDFEALVNLLAPD
201 VVLTADAAATPAAIAVMLRGSQEVARAAVASALRAPFARIALLDGAPGLV
251 VAPRGHLRLVLAFTVDGGRISAVDVVADRRRLRALEVSLADL

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more