ECF proteins of ECF subgroup ECF41s2

Displaying ECF 61 - 80 of 1206 in total
Name Aliases LCA Taxa Group Subgroup
ECFp13240
  • RNA polymerase subunit sigma-70
  • SVTN_RS20165
Streptomyces vietnamensis ECF41 ECF41s2

>ECFp13240 ECF41 ECF41s2 Streptomyces vietnamensis

1 MTGRERGDRRVDHTEKVDKGFLARRFDADRGHLRAVAYRMLGSLSEAEDA
51 VQEAWFKLSRSDVSGVENLSGWLTTVVGRVCLDMLRSRGSRREDPLEYYV
101 PDPVVRVADTTDPEHAAELTESVGLALLVVLDTLGPAERLAFVLHDMFAV
151 SFDEIAKIVDRTPAATRQLASRARRRVQDATPAPGPDARRQREIADAFLA
201 AAHGGDFEGLLAVLDPDVVLRADGGRTLAAVSKVVRGAEAVIAQALTYAK
251 FRTGVLQVVANGQPAVVSVVQGRPGSIMTFTIVEDRIVELHILADPERMA
301 VLGLTEEDLARAEY

>ECFp13297 ECF41 ECF41s2 Streptomyces rubellomurinus subsp. indigoferus

1 MTGKDFLADGFEAERAQLRSVAYRMLGSVAEAEDAVQEAWLRLERSDVSE
51 VRNLGAWLTTVVGRICLDQLRSRASRKEDPLPEEDGRVRLPDPVIGGLVA
101 LDPVQEILVADSVGLALMVVLETLSPAERVAFVLHDLFEVPFDAIADVLG
151 RTSAATRQLASRARRRVQGATPAADTDTGRKQQVVEAFLAAARGGDFEAL
201 LTVLDPDVLARSDGGTLVPGVLRRGAAAVASQAITFARFAAEARLVLVNG
251 SPGVVSYAEGRPLSVMSFTIHAGRITGLDILTDPTRLAALAPTP

>ECFp13408 ECF41 ECF41s2 Streptomyces sp. NRRL S-1824

1 MDEQELLAARFEEHRPRLRAVAYRMLGSAAESDDAVQGTWLRLSRTDVGD
51 VANLGGWLTTVVARVSLDMLRSRETRREDPWESHLPGPAGGRDVGIEPEE
101 QAELTDSVGLALLVVLDTLSPAERLAFVLHDMFAVPFDEIAPIVELTPAA
151 TRQLASGARRRVQGTVPDPGTELARRREVVDAFLAASRGGDFEALPALLD
201 PDVVLRVDPAAALSGVAGAVGATAVAGTFAGRASAAQPALIDGLPGAVWA
251 PGGGPRVVIAFTIEAGRIVSIDLVADADHLGRMDLRILDV

>ECFp13419 ECF41 ECF41s2 Streptomyces rubellomurinus

1 MSGDGFPDGSGVEPAARFEAERGRLRAIAQRMLGSTGEAEDAVQEAWLRL
51 VRTDAAEIDNLPGWLTTVVSRICLDLLRARAARREEPAGEALPEAVSEGT
101 DPEREAVLVDSVGRALLVVLDRLGPAERVAFVLHDGFAVPFEQIAPIVGR
151 TPVAAKKLASRARQRVRGTAALPPEPLAGHRRVVEAFLAAARGGDLAELL
201 AVLAPDVVRRADPAALPPGRALVARGARTVAGETTVFGRRARYGAVALVD
251 GLPGILIAPDGRLRLVLRMAVADGRVAGYEVVADPGRLAALELAVLEPAV
301 LEPAVLGSGVLGSAVLPR

>ECFp13432 ECF41 ECF41s2 Streptomyces canus 299MFChir4.1

1 MSERDWMAAQFEEHRPRLRAVAHRMLGSLGEADDALQDAWLRVDRADTSG
51 VENPGGWLTTVVARVCLNLLRAREARREEELSADRIPASAARVTDPEEEA
101 LLADSVGLALLIVLDTLAPAERLAFVLHDMFQVPFDEIAPLIDKTPAATR
151 QLASRARRRVKGAPAPAAPTADASRRHRVVHAYLAATRGGDFDALLALLH
201 PDVVLHADRAVVPTPEPVLVRGARPVAEGAMASLGRARSAALVLVDGEVG
251 MAMLEEGRLRVLLRFTFDGDLIREIDVVAEPDRLRKMEVAVVEGLAAAGV

Name Aliases LCA Taxa Group Subgroup
ECFp13477
  • DNA-directed RNA polymerase sigma-70 factor
  • OO71_RS28185
Amycolatopsis jejuensis ECF41 ECF41s2

>ECFp13477 ECF41 ECF41s2 Amycolatopsis jejuensis

1 MQDENFWAAQFEEHRPRLRAVAYRMLGSFAEADDAVQETWLRVTRSSGDD
51 VRNIGSWLTTVVSRQCLNMLRSRATRREDPLDVRVPDPVVESGDGVDPAE
101 QEVLADSVGLALLVVLEALDPAERLAFVLHDMFAVPFDEIASMLDRTSAS
151 VRQLASRARRRVQGATPAGPPNRSQQRRIADAWLTAARGGNFDGLVALLH
201 PDALLRVDTGGPDSKVVRGAAEVAGNASRFRPVGLVSHYAVVNGGPGIVA
251 TRDGKPVSVLAFTVSDGLIVEIDILADVERLATLDISVN

>ECFp13527 ECF41 ECF41s2 Rhizobium leguminosarum bv. viciae 248

1 MDEKKWLTDEFEANRAHLRAAAYRMLGSRSEAEDAVQEAWLRLSRTDTTG
51 VGNLGGWLTTVVARICLDMLRARKTRREEPLEAPVHAGTADPANDPEREA
101 AFADSVGLALLVVLQTLAPAERVAFVLHDMFDLPFDEIAPIIGRSSGATR
151 QLASRARRRVQGVDEAPDVDFGRKRTIAEAFLTASRNGDLEGLIAVLAPD
201 VVFRPDATAARFGTIGEMRGAAHVAEAFKGRAQAAEIAIVGGELGFVVEI
251 KGQLRVVVALTIADGRIAAIDAIADPEHLERLDYSILGD

>ECFp18508 ECF41 ECF41s2 Rhodococcus

1 MNDNEVLAHRFEENRTHLSAVAYRMLGSISEAEDAVQEGWLRLSRADASD
51 VENLPGWLTTVVARVCLDMLRSRKTRREEPLDVHVPDPIVSELDGADPEH
101 EAVLGDSVGLALMVVLDTLTPAERIAFVLHDMFALSFDEIAPIAGRTPAA
151 SRQLASRARRRVQGSGPVADTDLTRQREVVEAFMAASRGGRFDDLLALLD
201 PDIVLRADGGADGSSLVRGARAVSEQALTFSRFAPFARLALVNGAAGVVT
251 APEGKAMSVMAFTVAGGKIARIDILADPQRLQRLGLSAVDD

Name Aliases LCA Taxa Group Subgroup
ECFp13631
Rhizobium sp. CF048 ECF41 ECF41s2

>ECFp13631 ECF41 ECF41s2 Rhizobium sp. CF048

1 MDEKNWLAGEFEANRAHLATVAYRMLGSRTEADDAVQEAWLRLGRSDADL
51 IDNMGGWLTTVVARICLDMLRSRKTRREEPFDLPVHERLADTSKTVDPEQ
101 EVAFADSVGVALLIVLETLAPAERVAFVLHDMFDLPFDDIAPIINRSSAA
151 TRQLASRARRRVQGTTDVPETDAAHKRTIVNAFLAASRLGDLNALLAVLD
201 PQVVFTPDATAMRYNPSVRELRGASAVAETFKGRAQAAQPALIDGEFGLV
251 VSVAGDLRVVLLLAFDGDKIAAIDAVADRDYLDHLQYELLEP

Name Aliases LCA Taxa Group Subgroup
ECFp13791
Frankia ECF41 ECF41s2

>ECFp13791 ECF41 ECF41s2 Frankia

1 MDERLARSFEEHRGHLRTVAYRMLGSLDEADDAVQDAWLRLSRSDVGGVE
51 NLGGWLTTVVARICLNMLRARRTRPEDLVGVHVPDPIIGLAPTAGAGQPE
101 QEALLADSVGLALITVLDTLAPAERLAFVLHDLFDLPFDEIAPMVGRSPA
151 AARQLASRARRRVRALDTPVPDAVHADHADQRRVVDAFFAAARGGDVTSL
201 VAVLDPDVVLRADGGTGRPQASAVVCGARDVARRALLFAQPAAVVHPVLV
251 NGTAGVVITIDGRPVSVMGFVVADERIAEIHALVDAGRLARLDLAAWLGP
301 AGGERARTPRSR

>ECFp138255 ECF41 ECF41s2 Streptomyces sp. MUSC 1

1 MSEHDAHQHHDGTGGLDALAERFEAYRGHLRAVAFRMLGSAAEAEDAVQE
51 TWFRLSRSDTSEVDNLGGWLTTVVGRVCLDLLRSRRTRGEQPLETWEPAA
101 AAQDPAQDPAQDALLADSVGSALLVVLDQLNPAERLAFVLHDLFGVPFDE
151 VGGVLGRTPAAARQLASRGRRRVRGADAPETDLVRQRAVVDAFLAAARDG
201 DFEGLLAVLDPDVLARGEAGTTIGASGVAAGAKSFARLAVESRPALIDGA
251 TGLVRYVDDRLERALTFTFVADRIATIDIVTDPARLTELTIEPTQT

>ECFp138338 ECF41 ECF41s2 Alloactinosynnema sp. L-07

1 MDELAARFESHRTHLRGVAYRMLGSAPEAEDAVQEAWFRLSRTDVSAVDN
51 LAAWLTTVVSRICLDLLRSRAARREDTVGEVPDRIAEAGDPQAEAILVDS
101 VGRALLVVLNTLSPAERVAFVLHDLFAVPFDRIAPIVGRTPVATKKLASR
151 ARQRVQGTPAVSEDRLTHQRQVVDAFLAAARAGDLDGLLAVLAPDVVRRA
201 DAAALPLGVATVVRGARAVAEETVVLRRNSRFAVPMLVDGAVGIVVAPHG
251 RVLLALIVTVEDGRITKYDVVADPARLRGLDLAAHSGEDSA

>ECFp13838 ECF41 ECF41s2 Streptomyces diastatochromogenes

1 MGENVLAAERFEEHRSHLRAVAYRMLGSLSEADDALQEAWLRVGRTDTSG
51 VENLAGWLTTVVARVCLNLLRTRERQREESLDVHVDARVADAVVGPAGGR
101 DPEEEAVLADSVGVALLVVLDTLGPAERLAFVLHDMFAVPFDEIGPMLER
151 SPAAVRQLASRARRRVKGASPPPESDLARRYRVVDAFLAATRGGNFDALV
201 ALLHPDVVLHADKAVIPTPEPVVVRGAHTVAKGATAATGRAAFTGVALVD
251 GAVGLAMAPRGRLSVVLVFAFTDGLITEIDVIAEPERLGRLEIAVLDN

>ECFp138389 ECF41 ECF41s2 Micromonospora sediminicola

1 MGDTLAERFERQRPRLRAVAYRLLGSLSEAEDAVQETWLRLARADAGAID
51 NLDAWLTTVVARVSLNTLRSRAARREDPFDGHLPDPVVEPDADPAHAAVL
101 ADAVGLALLVVLDTLTPTERLAFVLHDMFGVPFDEIGPLVDRSPAAARQL
151 ASRARRRVRGQAPAPDPDLARQRAVVDAFLTAARDGDFDALIAVLHPDVV
201 LRSDGGTARARHTTVLTGAPAVAAQATTFGRLSPYARPVLVNGAAGVLVS
251 AGGRTLSVMAFTVVAGRVAAVDVIADPRRLAALGLAG

>ECFp138461 ECF41 ECF41s2 Micromonospora tulbaghiae

1 MMDTGLAERFERERPRLRAVAYRLLGSLTDAEDAVQETWLRLSRADAASV
51 DNLDAWLTTVVARVSLNTLRSRAARREDPLDVRLPDPVVDAGAGDPAQAA
101 VLADSVGLALLVVLDTLTPAERLAFVLHDMFGVPFDEIGPLVDRSPAAAR
151 QLASRARRRVRGQAPTPDPDLTRQRAVVDAFLAAARDGDLDALIAVLHPD
201 VVLRSDAGSAHARHTVVLTGAATVAAQATTFGRLFPHARPVLVNGAAGVL
251 VTAGDRPLSVMAFTVTGGRIAAVDVIADPHRLAALGLAG

>ECFp138552 ECF41 ECF41s2 Streptomyces lividans 1326

1 MRGEQDVRRQRDARGQQRLAERFEEHRGQLKAVAYRMLGSLAEAEDAVQE
51 AWLRLDRSEADGIDNLGAWLTTVTGRICLDLLRSRTARREEPMTEGFDSF
101 VPDPVLRALPRADPEAEALHTDSVGIALLVVLERLEPAERLAFVLHDMFA
151 VPFDDIAAVVERSPAATRQLASRARRRVRDATPAAEPDLGRQRRVVEAFL
201 AASRAGDFEALVSVLHPDVVLRADAGALARGVAASKVVRGARTVATGAFH
251 FRHLAPLARVVLVNDAVGTVAVSDGRPVSVTYVTVTDGLITGLYILSDPE
301 RLAGLDVSGLEA

>ECFp138597 ECF41 ECF41s2 Bradyrhizobium sp. cf659

1 MTQKNFEDNFLSQQFEASRDHLRAVAYRMLGSSAEVDDAVQEAWLRVSRY
51 DMSDVANLRGWLTTVVARICLDMLRARKSRREDPMGPHVPEPVDETRERD
101 AEMADSVGAALLIVLETLQPAERLAFVLHDMFAVPFEEIAPIVGRSVDAS
151 RQLASRARRRVQGAPVPETDLSHQRKIVDAFLAASREGNFEGLLAVLDPD
201 VVFRADEAAVRLGTLPEIRGADAVAQLYKGRAQAARTALVDGEMGVAVIL
251 GGQLRIALRVTFSGDRIAAIEAVADADEIAAIEVEVLER

>ECFp138620 ECF41 ECF41s2 Streptomyces

1 MGEDGELLARSFEEHRAHLKAVAYRMLGSLAEAEDAVQEAWLRLGRVEPG
51 EIDNLGGWLTTVTGRICLDLLRSRSARREQPMDDTFVPDPVIRPLSRVDP
101 EQEALEADSVGIALLVVMETLDPDERLAFVLHDLFAVPFDDIAPVLERTP
151 AATRQLASRARRRVRDTAPPSDPDTARQREALDAFRAAARLGDFEALLAV
201 LHPDVVLRADAGALVRGPAGSKRLRGARRVAESAMLFSRFNATARTVLVN
251 GAPGLVTVTDGRVGSVLAATVHEGRITALFILADPERLEGLVLPDEAV

Name Aliases LCA Taxa Group Subgroup
ECFp138642
  • DNA-directed RNA polymerase sigma-70 factor
  • D455_RS0121765
Nocardiopsis halotolerans DSM 44410 ECF41 ECF41s2

>ECFp138642 ECF41 ECF41s2 Nocardiopsis halotolerans DSM 44410

1 MTGSVSEEVAEAFEEQRGRLVAVAYRMLGTRADAEDAVQEAWLRLARQDA
51 ASIDNLAGWLTTVVGRVCVDMLRSRGARAEASYEELPEFVVTEDDDGAPE
101 DDALLADAVGLALLVVLDTLRPAERLAFVLHDMFAVPFDEIGQILGRSTD
151 AAKMLASRARRKVRDGHRPGDERRRQRAVVDAFLTAARSGDFEGLLRVLD
201 PEVRLRAHTAGGVVVRLGATEVSDEFRRGMRARVTARRVLVNGEPGIAVW
251 NANGAPLGVMACTVVDGRIVEILSVVGPRRLAEMDIPAAAGASSS

Name Aliases LCA Taxa Group Subgroup
ECFp138778
  • RNA polymerase sigma factor
  • G419_11317
  • ... more
Rhodococcus triatomae BKS 15-14 ECF41 ECF41s2

>ECFp138778 ECF41 ECF41s2 Rhodococcus triatomae BKS 15-14

1 MTDTEILTRRFEEHRDHLRAVGFRMLGSTSEADDAVQETWLRLNRAGADD
51 VANLGGWLTTVLSRVCLDMLRTRSSRDEVPLESPALPEPRESTDAGPESE
101 ALLADSIGVALLVVLDTLAPAERLAFVLHDLFGMPFDDVARIVGRSPAAT
151 RQLTSRARRRVQGGSPDTADTRRRDRVVEAFLAASREGRFEDLLDLLDPD
201 VVLRADAIAVTTSGAAVAHGAPPLTAEMHGALAVATTFSGRAKGAQVVTV
251 DGIRGVAYAPGGRPRAVFSFTIVGDRIVAVHAVADPGTIAALDVVLDSGA

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more