ECF proteins of ECF subgroup ECF41s2

Displaying ECF 41 - 60 of 1206 in total
Name Aliases LCA Taxa Group Subgroup
ECFp19681
Rhodococcus opacus ECF41 ECF41s2

>ECFp19681 ECF41 ECF41s2 Rhodococcus opacus

1 MTDNEVLAHRFEENRTHLSAVAYRMLGSISEAEDAVQEGWLRLSRADTSD
51 VENLRGWLTTVVARVCLDLLRSRKTRREEPLDVHVPDPIVSEDGADPEHE
101 AVLGDSVGLALLVVLDTLTPAERLAFVLHDMFALSFDEIAPIAGRTPAAS
151 RQLASRARRRVQGSGLVPDTDPTRQREVVEAFMAASRAGRFDDLLALLDP
201 DIVLRADGGADGSSLVRGARAVSEQALTFSRFAPFARLALVNGAAGVVTA
251 PEGKAISVMAFTVAGGKIARIDILADRHRLQRLGLSAGGD

>ECFp19122 ECF41 ECF41s2 Streptomyces

1 MAERFEEHRAHLRAVAYRMLGSLSEADDAVQESWLRLSRSDVSGVGNLGG
51 WLTTVVGRVCLDMLRSRTARGEESLDVRVPDPVVGGGADGIDPEHQALLA
101 DSVGLALLVVLQTLAPAERLAFVLHDMFAVAFEEIGPVVGRTPAAARQLA
151 SRARRRVRGTATPDTDLARQREVVDAFMAASRGGDFEALVAVLDPDVVLR
201 ADTGAGFPGLAATARGAREVAGRAFMFRRFAHFARPALVNGAMGIVTVAD
251 RGPVSVMGLTIAGGKIVAIDILADPERLRGLGLGLEVEREGRG

Name Aliases LCA Taxa Group Subgroup
ECFp18769
  • DNA-directed RNA polymerase sigma-70 factor
  • A3CU_RS0102005
Amycolatopsis taiwanensis DSM 45107 ECF41 ECF41s2

>ECFp18769 ECF41 ECF41s2 Amycolatopsis taiwanensis DSM 45107

1 MDEREFLAERFEEHRTHLRAVAYRMLGSLSEAEDAVQEAWLRLSRNGVGE
51 VENLGGWLTTVVGRVCLNMLRSRVRRREEPLNPYVPDPVVDFAERTSPEH
101 EALLADSVGLALLVVLETLAPAERLAFVLHDMFSVPFDEIAPVIGRTPAA
151 TRQLASRARRRVQGAPAPDTDLTRQREVVDAFITASRGGDLEALVELLDP
201 DVVLRGDGGATGPSTFLRGAQAVAQGASAFGRLVAHTHPAIVNGVAGAVA
251 MLDGRPLSVAAFTVARGKIVALDILADPERLARLGLR

Name Aliases LCA Taxa Group Subgroup
ECFp18504
Rhodococcus opacus ECF41 ECF41s2

>ECFp18504 ECF41 ECF41s2 Rhodococcus opacus

1 MNENDMLAQQFEAHRTHLRAVAYRMLGSIGEAEDAVQESWLRLSRTDART
51 VENLGGWLTTVVARVCLNMLQSRRSRREDPLDAAVPDPIVTRADGSDPEH
101 EAVLADSVGLALLVVLGTLTPAERLAFVLHDMFAVPFEDIAPIVERTPAA
151 ARQLASRARRRLQGAPVPDTDPVRQRAVVDAFLAAARSGDFDALVAVLDP
201 DVVLRADTGALPAGASTMVRGSETVASRVLGFARLARFAHPALVNGAAGV
251 VAISDGQLLSVMGVTIRRGKIVEIDILADRERLAGLVVENLD

>ECFp18155 ECF41 ECF41s2 Streptomyces rimosus subsp. rimosus

1 MAERFEEHRAHLRAVAYRMLGSLSEADDAVQESWLRLSRSDVSGVGNLGG
51 WLTTVVGRVCLDMLRSRTARGEESLDVRVPDPVVGGADGIDPEHQALLAD
101 SVGLALLVVLQTLAPAERLAFVLHDMFAVPFEEIGPVVGRTPAAARQLAS
151 RARRRVRGTATPDTDLARQREVVDAFMAASRGGDFEALVAVLDPDVVLRA
201 DTGAGFPGLAATARGAREVAGRAFMFRRFAHFARPALVNGAMGIVTVADG
251 GPVSVMGLTIAGGKIVAIDILADPERLRGLGLEVEREGRG

>ECFp171957 ECF41 ECF41s2 Rhodococcus koreensis

1 MNENDVLAQQFETHRRHLRAVAYRMLGSLTEAEDAVQESWLRLSRTDTDS
51 VENLGGWLTTVVARVCLNMLQSRRSRREEPLDGQVPDPIVTLTDGSSPEQ
101 EAVLADSVGLALLVVLGTLTPSERLAVVLHDMFAVPFEDIAPIVERSPAA
151 ARQLASRARRRLQGAPVPDTDPVRQRAVVDAFLAAARGGDFDALVAVLDP
201 EVVLRADTGAFPAGASTMVRGAETVAGRVLGFARLARFAHPALVNGTAGV
251 VAISEGQLLSVLGVTIRQGVIVEIDILADRERLAGLVVENLD

>ECFp17136 ECF41 ECF41s2 Streptomyces albus subsp. albus

1 MDENEFLAERFEEHRAHLRAVAYRMLGSLSEADDAVQESWLRLSRSDVSG
51 VGNLGGWLTTVVGRVCLDMLRSRTARGEESLDVRVPDPVVGGADGIDPEH
101 QALLADSVGLALLVVLQTLAPAERLAFVLHDMFAVPFEEIGPVVGRTPAA
151 ARQLASRARRRVRGTATPDTDLARQREVVDAFMAASRGGDFEALVAVLDP
201 DVVLRADTGTGFPGLAATARGAREVAGRAFMFRRFAHFARPALVNGAMGI
251 VTVADGGPVSVMGLTIAGGKIVTIDILADPERLRGLGLG

Name Aliases LCA Taxa Group Subgroup
ECFp1635
  • DNA-directed RNA polymerase sigma-70 factor
  • probable sigma factor, includes region 2
  • ... more
Rhodococcus ECF41 ECF41s2

>ECFp1635 ECF41 ECF41s2 Rhodococcus

1 MNDNDVLAQQFEAHRTHLRAVAYRMLGSLSEAEDAVQESWLRLSRTDADT
51 VENLGGWLTTVVARVCLNMLQSRRTRREDPLDAAVPDPIVTRADGSDPEH
101 EAVLADSVGLALLVVLGTLAPAERLAFVLHDMFAVPFEDIAPIVERTPAA
151 ARQLASRARRRLQGAPVPDTDPVRQRAVVDAFLAAARSGDFDALVAVLDP
201 DVVLRADTGAVPAGASTMVRGSATVAGRVLGFARLARFAHPALVNGAAGV
251 VAISDGQLLSVMGVTIRRGKIVEIDILADRERLAGLVVENLD

>ECFp16228 ECF41 ECF41s2 Saccharothrix sp. NRRL B-16348

1 MSHRGRSIRHLPDGWNTEDVTVIDDELLATRFEADRSHLKAVAYRVLGSM
51 SEADDAVQEAWVRLQRADTRDVDNLTGWLTTVVGRVCLDMLRSRASRRED
101 PLDVRVPELVVEPADGGDPEHEAVMADSVGTALLVVLGTLAPAERLAFVL
151 HDLFAVPFDDIAPIVGRTPAATRQLASRARRRVQGAPVPDDLPRQRRVVD
201 AFTAAARDGDFEALLTVLDPDVVLRVDLGALNPDLTAAVRGAAEVAGQAL
251 RFRQPAAVSRRVLVNGGMGILVAADGKPTSLMSFTVSGGRIVAIDVLSDP
301 ERLAGLDLSALDLPRRT

>ECFp15720 ECF41 ECF41s2 Streptomyces sp. NRRL F-5755

1 MAERFEEHRAHLRAVAYRMLGSLSEADDAVQESWLRLSRSDVSGVGNLGG
51 WLTTVVGRVCLDMLRSRTARGEESLDVRVPDPVVGGADGIDPEHQALLAD
101 SVGLALLVVLQTLAPAERLAFVLHDMFAVPFEEIGPVVGRTPAAARQLAS
151 RARRRVRGTATPDTDLARQREVVDAFMAASRGGDFEALVAVLDPDVVLRA
201 DTGTGFPGLTATARGAREVAGRAFMFRRFAHFARPALVNGAMGIVTVVDG
251 GPVSVMGLTIAGGKIVAIDILADPERLRGLGLGREVGGEGRG

Name Aliases LCA Taxa Group Subgroup
ECFp13816
  • DNA-directed RNA polymerase sigma-70 factor
  • YWW_RS0126735
Glycomyces tenuis ECF41 ECF41s2

>ECFp13816 ECF41 ECF41s2 Glycomyces tenuis

1 MSERTDLAERFEEQRPRLRAVAYRMLGSFSEADDALQEAWLRAGRTDTGE
51 VDNLGGWLTTVTARVCLNMLRSRRRRREEPIDVHVPDPVVSPESGLDPEH
101 EALLADSVGLALQVVLETLAPAERLAFVLHDMFAVPFEDIAGVIEKSPAA
151 ARQLASRARRRLEGRTAAETDPRRQREAVAAFFAASHRGDFDALVAVLDP
201 DVVLRADGGTARPALNTILRGAQTVAGQAALYRRFVPLAHPVLVNGAVGR
251 LIVDESGPFAVMSFTVADGRITAIDVLADPERLRRLDLPNPDERDR

Name Aliases LCA Taxa Group Subgroup
ECFp13242
  • RNA polymerase subunit sigma-70
  • OO63_RS28985
Streptomyces ECF41 ECF41s2

>ECFp13242 ECF41 ECF41s2 Streptomyces

1 MDGRDLLAQRFEEHRPRLRAVAYRMLGSLSEAEDAVQETWLKLSRADDER
51 VENLGGWLTTVIGRVCLDLLRSRKQRGEQPLDVQGADTHVPDPEVSPLPG
101 GRDAVDPEQEALLADSVGLALLVVLDTLSPAERLAFVLHDMFAVPFEDIA
151 PIVERAPAATRQLASRARRRVRDADRTPGPDSDRTRQRKVVEAFLAAARK
201 GDFDALLELLDPGVVLRADGGGAEGLSRLVRGATAVVAGARSFATLAPTT
251 YLALVNGKVGQIAVHNGEPFSVGEFTVRDGRIVEINILADQERLRDLVDE
301 RTVAAVMSAGSVGDAGGGSGVAAGADATPEAVDGAPPAAD

>ECFp13111 ECF41 ECF41s2 Streptomyces rimosus subsp. rimosus

1 MDENDFLAERFEEHRAHLRAVAYRMLGSLSEADDAVQESWLRLSRSDVSG
51 VGNLGGWLTTVVGRVCLDMLRSRTARGEESLDVRVPDPVVGGGADGIDPE
101 HQALLADSVGLALLVVLQTLAPAERLAFVLHDMFAVPFEEIGPVVGRTPA
151 AARQLASRARRRVRGTATPDTDLARQREVVDAFMAASRGGDFEALVAVLD
201 PDVVLRADTGAGFPGLAATARGAREVAGRAFMFRRFAHFARPALVNGAMG
251 IVTVADGGPVSVMGLTIAGGKIVAIDILADPERLRGLGLELGPEVEREGR
301 G

>ECFp13095 ECF41 ECF41s2 Streptomyces rimosus subsp. rimosus

1 MDENDSLAERFEEHRAHLRAVAYRMLGSLSEADDAVQESWLRLSRSDVSG
51 VGNLGGWLTTVVGRVCLDMLRSRTARGEESLDVRVPDPVVGGADGIDPEH
101 QALLADSVGLALLVVLQTLAPAERLAFVLHDMFAVPFEEIGPVVGRTPAA
151 ARQLASRARRRVRGTATPDTDLARQREVVDAFMAASRGGDFEALVAVLDP
201 DVVLRADTGAGFPGLAATARGAREVAGRAFMFRRFAHFARPALVNGAMGI
251 VTVADGGPVSVMGLTIAGGKIVAIDILADPERLRGLGLGPEVEREGRG

Name Aliases LCA Taxa Group Subgroup
ECFp13083
Rhodococcus sp. LB1 ECF41 ECF41s2

>ECFp13083 ECF41 ECF41s2 Rhodococcus sp. LB1

1 MNDNEVLAHRFEENRTHLSAVAYRMLGSLSEAEDAVQEGWLRLSRADASD
51 VENLPGWLTTVVARVCLDMLRSRKTRREEPLDVHVPDPIVSELDGADPEH
101 EAVLGDSVGLALMVVLDTLTPAERIAFVLHDMFALSFDEIAPIAGRTPAA
151 SRQLASRARRRVQGSGPVADTDLTRQREVVEAFMAASRGGRFDDLLALLD
201 PDIVLRADGGADGSSLVRGARAVSEQALTFSRFAPFARLALVNGAAGVVT
251 APEGKAMSVMAFTVAGGKIARIDILADPQRLQRLGLSAVDD

>ECFp12849 ECF41 ECF41s2 Streptomyces rimosus subsp. rimosus

1 MDENEFLAQRFEEHRAHLRAVAYRMLGSLSEADDAVQEAWLRLNRSDTSG
51 VGNLGGWLTTVVGRVCLDMLRTRTARGEESLDVRVPDPVIGGGADGIDPE
101 HQALLADSVGLALLVVLQTLAPAERLAFVLHDMFAVPFEEIGPVVGRTPA
151 AARQLASRARRRVRGTATPDTDLARQREVVDAFMAASRGGDFEALVAVLD
201 PDVVLRADTGAGFPGLAATARGAREVAGRAFMFRRFAHLARPALVNGAMG
251 IVTVADGGPVSVMGLTIAGGKIVAIDILADPERLRGLGLGLGPDVEVAEE
301 RAGRG

>ECFp12694 ECF41 ECF41s2 Rhodococcus sp. UNC363MFTsu5.1

1 MDENDWLALRFEEHRTHLRAVGYRMLGSLSDADDAIQETWLRLSRSEADS
51 LTNLGGWLTTVMGRVCLDMLRSRKVRREDSIDDQQLPDPIVGVVEGTNPE
101 HEALLGDSVGLALLVVLDTLTPAERLAFVLHDMFAVPFDEVAAVVGKSTA
151 TTRQLASRARRRVQDSTPVPDPDLVRQREVVDAFLAASRGGDFDALVAVL
201 DPDVVLRADTGAGFLKVVRGAEAVSAQALSFARFAHSSMPALVNGAVGMV
251 NAPDGRLQSVMAVTITNGLIVEIHILADRPRLERLDREAARG

>ECFp17391 ECF41 ECF41s2 Streptomyces roseochromogenus subsp. oscitans DS 12.976

1 MDDFTEDAGRRLAARFEADRSHLTAVAHRLLGSATEADDALQEAWLRARE
51 ADLDEVRNLTGWLTTVVTRVCLNLLRARRNRREEFLDAQDARNARDDRDA
101 RDTVHDTPAFSAEAGDPAREALLADEVGVALLVVLDTLSPAERVAFVLHD
151 MFAVPFEEIAPLVERTPAATRQLASRARRRVQGRTPAPAADAVRRRRAVE
201 AFLAATRGGDFTALVALLDPDVVLHADALVVPTPAPITVRGAEPVARGAM
251 AAMARAQVTGLALLDGEFGLVMAPYGRPRLVLAFAFGTDGRITRIDVVAE
301 PERLRGTEIAVVDPAQTGTGGPGKVDH

>ECFp172890 ECF41 ECF41s2 Streptomyces sp. 1222.5

1 MDDFTGDAGQRLAERFEADRPHLAAVAYRLLGSATEADDALQEAWLRARQ
51 ADTGEVGNLTGWLTTVVTRVCLNLLRARRNRREDALDAHDSPAAAVTESG
101 DPAREALLADEVGIALLVVLDTLSPAERVAFVLHDMFAVPFEEIAPLIER
151 NPAATRQLASRARRRVRGREPVPTADAGRRRAAVEAFLAATRGGDFTALF
201 ALLAPDVALRADALVVPTPEPLTVQGAEPVARGAMAAMARARLTGVALLD
251 GRVGLVMAERGHPRLVLAFTFGTDGLISGIDITADPERLRGIDIGPADTD
301 R

>ECFp172095 ECF41 ECF41s2 Streptomyces sp. CB01883

1 MDDFTGDAGQRLAARFEADRPHLTAVAYRLLGSATEADDALQEAWLRARQ
51 ADTGEVGNLTGWLTTVVTRVCLNLLRARRNRREDALDAHDSPAAAVTESG
101 DPAREALLADEVGIALLVVLDALSPAERVAFVLHDMFAVPFEEIAPLIDR
151 NPAATRQLASRARRRVRGREPVPTAGAGRRREAVEAFLAATRRGDFTALF
201 ALLAPDVVLRADALVVPTPEPLTVQGAEPVARGAMAAVARARLTGVALLD
251 GRIGLVMAERGHPRLVLAFTFGTEGLITGIDITADPERLRAIDIGPADTG
301 R

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more