ECF proteins of ECF subgroup ECF41s2

Displaying ECF 221 - 240 of 1206 in total

>ECFp10829 ECF41 ECF41s2 Amycolatopsis alba DSM 44262

1 MDEHDWLARRFEGHRTHLRAVAYRMLGSLSEADDAVQEAWLRLSRAGSED
51 VDNLGGWLTTVVGRICLDMLRSRKSRQEDPVGAQLPDPIIGREGGIDPEH
101 QALLADSVGLALLVVLDTLDPAERLAFVLHDMFALPFDEIAPIVGRSSAA
151 TRQLASRARRRLQGSPTVPDADLGRQRAVVDAFFAAARDGDFDALVSVLD
201 PDVILRAEGGAAPAGTSRFVRGAATVASQALMFRATGDGGVPHPALVNGA
251 AGMVITKDGVPATVFAFTVVDGRIAAIDILADPDRLAALDFEPLD

>ECFp14068 ECF41 ECF41s2 Streptomyces viridosporus T7A

1 MNDEELLAERFEEHRGHLRAVAYRMLGSLTEAEDAVQEAWLRLGRTDPGE
51 IGNLGGWLTTVTGRICLDLLRSRTARREQPMDETFVPDPVIRPLPRTDPE
101 QEALRADSVGVALLVVLDRLAPDERLAFVLHDMFAVPFDDIAPVVGRTAA
151 ATRQLAGRARRRVRDATPSSEPDPGRQKEALDAFMAAARGGDFEALVAVL
201 HPDVVLRADAGALVRGAAGSKTLRGAKPVAESALLFARYTAAARMALVND
251 AIGLVSVVEGRIRSVMSVTVTDGRITGLYILADPERLARLEVPDDEA

Name Aliases LCA Taxa Group Subgroup
ECFp18394
  • RNA polymerase subunit sigma-70
  • IG78_RS0107995
Streptomyces aureocirculatus ECF41 ECF41s2

>ECFp18394 ECF41 ECF41s2 Streptomyces aureocirculatus

1 MDGRELLAARFEEHRPRLKAVAYRVLGSLSEAEDAVQETWLKLSRADGER
51 VENLGGWLTTVVGRVCLDLLRARKQRGEQPLDVEVPATHVPDPQISPLPG
101 GREPVDPEQEALLSDSVGLALLVVLDTLGPAERLAFVLHDMFAVPFEDIA
151 PIVERSPAATRQLASRARRRVRDTAPEPGPDRTRHREVVEAFLTAARGGD
201 FDALLELLDPDVVLRADGGDVSGLSRFVRGAREVVAGARSFSALAGTTCL
251 ALVNGRVGQLAVHEGKPFSVGEFTVRGGRIVEINILADQERLRTLLDARA
301 IRELTGTDAGGGPEVGTGPGVGSGPGAGAGPESCTGPAAG

>ECFp19797 ECF41 ECF41s2 Streptomyces mangrovisoli

1 MDAEDVLAGRFEQERGRLRAVAYRMLGSLAEAEDAVQETWLKLSRTDAAE
51 IRNLSGWLTTVVGRVCLDLLRTRTSRREQPIDDVFTDTFVPDPVLRPLSR
101 IDPEQEVLQADSVGLALLVVLETLDPAERLAFVLHDMFAVPFDDIAPVVE
151 RSSAATRQLASRARRRVKGATPSADPDPGRQREAVEAFMAAARAGDFDAL
201 LAVLDPDVVLRADSGARISGPAASKVVHGARAVAEQALFFREFAPLSRVA
251 LVNGEPGLVNVVDGKAVGVMGLTVSGGRITGMYILADPERLARLDVSGLA

Name Aliases LCA Taxa Group Subgroup
ECFp11716
  • DNA-directed RNA polymerase sigma-70 factor
  • IF61_RS0122440
Streptomyces roseoverticillatus ECF41 ECF41s2

>ECFp11716 ECF41 ECF41s2 Streptomyces roseoverticillatus

1 MSEKNFLAEQAQRFEEHRPHLRAVAYRILGSLAEAEDAVQETWFKLSRSD
51 TSEVGNLGGWLTTVTGRVCLDMLRSRATRHEEPLHDGEGRVVSLPDPVIS
101 AADRVDPEQEILLADSVGIALMVVLQTLAPAERLAFVLHDMFHVPFDDIA
151 EVIDRTPAATRQLASRARRRVQGQAPAPDSDVAARRRVVDAFLAAARGGD
201 FDALVAVLDPDIVARSDGGTLLPSALRRGAAEVASQAIMFARFAEAALPA
251 LVNGTPGVVAVADGRAMSVMAFTIRGGRVTALDILTDPERLANLDLSALT
301 D

Name Aliases LCA Taxa Group Subgroup
ECFp11881
Streptomyces sp. 4F ECF41 ECF41s2

>ECFp11881 ECF41 ECF41s2 Streptomyces sp. 4F

1 MSAVGEDGELLARSFEEHRAHLNAVAYRMLGSLAEAEDAVQEAWLRLGRV
51 EPGEIDNLGGWLTTVTGRICLDLLRSRTARREQPMDDTFVPDPVIRPFSR
101 VDPEQEALEADSVGIALLVVMETLDPDERLAFVLHDLFAVPFDDIAPVLE
151 RTPAATRQLASRARRRVRDTAPPSDPDTARQREALDAFRAAARTGDFEAL
201 LAVLHPDVVLRADAGALVQGVEGSKRLQGARRVAESAMLFSRYNATARMV
251 LVNDAPGLVGVADGRVGSVLTATVHEGRITALYILADPERLRGLTLPDEE
301 DSHHV

>ECFp11943 ECF41 ECF41s2 Streptomyces tsukubensis NRRL18488

1 MNENDLLAERFEEHRGRLRAVAYRMLGSTGEAEDAVQEAWLRVSRAGTDD
51 VENLGGWLTTIVSRVCLNMLSSRARRQEDSLDVVRLPDPVIDKPEGRDPE
101 HEAELADSVGLALLVVLETLAPAERLAFVLHDLFAVPFDEIAPIVDRTPA
151 ATRQLASRARRRVQGTPAPETDVHRQRAVVNAFLAAAREGDFEGLIAVLD
201 PDVVVRSDWGGLRPGDIVRGAEQVARNAITYTRLAADARPALVNGAAGFV
251 SMAPDGSPFSVMAFTIRDGRIAEIDALAGADRLAALDLTVLGI

>ECFp12589 ECF41 ECF41s2 Actinobacteria bacterium OV320

1 MSENFFLADRFEAERPGLRAVAYRMLGSLAEAEDAVQEAWFKLSRTDVSD
51 VKNLGAWLTTVVGRICLDMLRSRTSRREDPLPEQDGSVRLPDPVVTALAR
101 VDPEREVLIADSVGIALMIVLEALSPDERLAFVLHDMFDVPFDDIAPSLG
151 RTAVSTRQLASRARRRVQGAVPAADTDNACKRDVVDAFLAASRGGDFEAL
201 LALLHPDAVARSDGGTLVPSILRRGAGDVASQAIAFARFAANARVVLVNG
251 TPGVVSFAGNRPLSVMSFTIRDGRITGLDILTDPDRLTTLGLTD

>ECFp11875 ECF41 ECF41s2 Rhodococcus wratislaviensis NBRC 100605

1 MNENDVLAQQFEAHRTHLRAVAYRMLGSIGEAEDAVQESWLRLSRTDADT
51 VENLGGWLTTVVARVCLNMLQSRRSRREDPLDAVMPDPIVTRADGSDPEH
101 EAMLADSVGLALLVVLGTLSPAERLAFVLHDMFAVPFDDIAPIVERTPAA
151 ARQLASRARRRLQGAPVPDTDPVRQRAVVDAFLAAARSGDFDALVAVLDP
201 DVVLRADTGALPVGASTTVRGSETVAGRVLGFARLARFAHPALVNGAAGV
251 VAIADGQLLSVMGVTIRRGKIVEIDILADRERLAGLVVENLD

>ECFp12023 ECF41 ECF41s2 Streptomyces

1 MSGEEMLARRFEEHRPHLRAVAYRMLGSLSEAEDAVQEAWLRLSRSDADA
51 VENLGGWLTTVVGRVCLDMLRSRTTRREDPLHDEDGRVRLPDPVVSRADS
101 LDPEQEVLLADSVGIALMVVLETLPPAERLAFVLHDLFAVPFDEIAPVLG
151 RTAAATRQLASRGRRRVQGVVPAPDPDPARLRAVVDAFLAASRGGDFAAL
201 VDVLDPEVVARSDGGALLPSLVRRGAAEVASQAITFARLAEAARPVLVNG
251 LPGVVALAEGRAMSVMAFTVRDGRIIALDILTDPERLARIDLSAVVDDA

>ECFp16411 ECF41 ECF41s2 Streptomyces lincolnensis

1 MDGHDELARRFEERRGRLRAVAHRMLGSAEEAEDAVQEAWLRLSRTDAGS
51 IDNLAGWLTTVVSRVCLDMLRSRAARREEPYGPRVPEPAGADAPEDEAVL
101 GDSVGLALLVVLERLGPAERVAFVLHDLFGVPFDQVAAVVNRSVPAAKKL
151 ASRARHKVRGTPAVPEAELDRHRRVVETFLAAARGGDLGGLLDVLAPDVV
201 RRADPAVLPPGVPAELRGARAVAEGTVALRERSRFAALALVDGDAGIVVA
251 PHGRLLLALPVTVRGGRITAYDVVADPARLRRIELGVLGPPAVSERSRTP

>ECFp172456 ECF41 ECF41s2 Streptomyces sp. CB02261

1 MTGRERGERRVDHDKELLARRFEADRGHLRAVAYRMLGSLGEAEDAVQEA
51 WIKLNRSDVSGVENLSGWLTTVVGRVCLDMLRSRGSRREDPLEYYVPDPI
101 VRLPDTADPEHTAEVTESVGLALLVVLETLSPAERLAFVLHDMFAVPFDE
151 IARIVDRTPAATRQLASRARRRVQDASPAPGPDARRQREIADAFLAAANG
201 GDFEGLLAVLDPDVVLRADGGKALAAASKIVRGAEAVVSQALTYARFRTA
251 ALPLLVNGAPAVLSVANGRPGALMAFTIAGDRIVELHILADPERLAALDL
301 SEEDLARATY

>ECFp10774 ECF41 ECF41s2 Terrabacter sp. Root85

1 MDDETREQWLARDFEQQRPRLRAVAYRVLGSAADADDAVQEAWLRLSRSD
51 TTEVTNLAGWLTTVVGRISLDMLRSRSSRREDSWDTGLAELVAGGDVRTA
101 LTQPTRPAPDPASEVELADSIGLALLVVLDTLAPAERLAFVLHDLFGMPF
151 EQIADILDRSPAATRQLASRARRRVRAADADGSGPARTRQREVVTAFLAA
201 ARGGDFSALLEMLDPDVVLSADEAAVAMGSPDVLRGPEAVAQRFNGGARS
251 ARLAAFDGGIGAVWTLRGEAMVAFRFTVDDRDLVTGIEMVADRARLDAME
301 ILFLTS

>ECFp16436 ECF41 ECF41s2 Streptomyces sp. 303MFCol5.2

1 MSENFFLADRFEAERPGLRAVAYRMLGSLAEAEDAVQEAWFKLSRTDVSD
51 VKNLGAWLTTVVGRICLDMLRSRTSRREDPLPEQDGSVRLPDPVVTALAP
101 VDPEREVLIADSVGIALMIVLEALSPDERLAFVLHDMFDVPFDDIAPSLG
151 RSAVSTRQLASRARRRVQGAAPAADTDNACKRDVVDAFLTASRGGDFEAL
201 LALLHPDAVARSDGGTLLPSILRRGAGDVASQAITFARFAANARVVLVNG
251 TPGVVSFAGNQPLSVMSFTIRDGRITGLDILTDPDRLTALGLTD

>ECFp17794 ECF41 ECF41s2 Actinobacteria bacterium OK006

1 MGENVLAAERFEEHRSHLRAVAYRMLGSLSEADDALQEAWLRVDRADPSG
51 VENLAGWLTTVVARVCLNLLRTRERQREESLDVHVDARVADAVVGPAGGR
101 DPEEEAVLADSVGVALLVVLDTLGPAERLAFVLHDMFAVPFDEIGPMLER
151 SPTAVRQLASRARRRVKGASPLPEADLARRYRVVDAFLAATRGGNFDALV
201 ALLHPDVVLHADKAVIPTPEPVVVRGAHTVAKGAMAATGRAAFTGVAHVD
251 GTVGLAMAPRGRLSVVLVFAFADGLITEIDVIAEPERLGRLEIAVLDN

Name Aliases LCA Taxa Group Subgroup
ECFp16527
  • hypothetical protein
  • STRPU_RS0117655
Streptomyces purpureus KA281 ECF41 ECF41s2

>ECFp16527 ECF41 ECF41s2 Streptomyces purpureus KA281

1 MEPGDVQGASEHTEATEHTEHPEHIELREPTEPGEAGEPRQLGTPRDRAY
51 ADALLAERFQAHRSHLRAVAYRMLGSLNEADDAVQEAWIRLSRSGTDGVE
101 NLGGWLTTVVGRICLDMLRSRTSRREEPLDEPGVRLPDPVVGAGDVIDPE
151 HAALLADSVGLALLVVLDTLAPAERLAFILHDLFAVPFDDIAPIVGRTPT
201 ATRQLASRARRRVQGAAPAPDCDLPRQREVVDAFLAAARGGDFEALVAVL
251 DPDIVARSDGGALRPGMLIRGAAAVAGQAITFARFAEASVPALVNGAAGV
301 LAMAEGRPISLMAFTIRDGKVTALDILTGPERLAALDLEPFTG

>ECFp17804 ECF41 ECF41s2 Actinomadura hibisca NBRC 15177

1 MNDDVLAERFAEQRPHLRAVAYRMLGSLSEADDALQDAWLRASRADLGEV
51 RNLGGWLTTVTARVCLNMLRSREQRREDPWESWTADPPTAKGNPEQEAVM
101 ADSVGVALLVVLDALTPAERVAFVLHDLFAMPFEEIAPMLERSPEATRQL
151 ASRARRRVRGGDPPRASDVTAQREIVTAFLSATRNGDFQALVTLLHPNVV
201 LHADKAVIPSPEPVMVSGAEPVARGAMAAVERAQFTGLGLIDGAVGLAMA
251 PGGRLRVVLAFTIANGLITGIDVIAEPDRLNEINLTVLD

>ECFp10793 ECF41 ECF41s2 Bradyrhizobium elkanii

1 MDEKNSLTEQFEANRPRLRAVAYRMLGSTAEVDDAVQETWLRLGRTDAAA
51 VDNLGGWLTTVIARICLDMLRSRKSRREEPIGPHVPEPIADNPSERETEM
101 ADSVGAALLVVLETLAPAERLAFVLHDMFAVPFEEIAPIVGRTPAAARQL
151 ASRARRRVQGTPPAPDADLSRQRGIVEAFLAASRNGDFEGLLAVLAPDVV
201 VRADQAAQRLGSLPVIRGAAAVAESFKGRAQAAKPALVDGGIGVAVIFGG
251 ALRIVLRVTISGDRIAMIDATADASQIETFDVEVLERG

>ECFp10483 ECF41 ECF41s2 Mesorhizobium sp. LSJC280B00

1 MKPDQWLAERFEADRKRLRKVAYRLLGSSTEADDAVQEAWLRLTRSDARS
51 VDNLTAWLTTVVARVCLDMLRARKSREETLQALSEWCADSGDAADLEKEL
101 VIADSVGLALSVVLEKLAPAERVAFVLHDVFDVPFEEIAPIVGRTPVMAR
151 QLASRARRRTRGQPTVSAAELNRRRRLVDEFLNAVRSGNIDAIVALLDPD
201 VVIRVDSSAAPDGRAVEAHGSTTVARGALAFAARTQFATPMLLNGAPGIV
251 VAPTGRARYALTIDAAGEKIRAIEVIGDPARLSQIDFATLNSPD

Name Aliases LCA Taxa Group Subgroup
ECFp10666
  • hypothetical protein
  • A3IC_RS0133455
Streptomyces scabrisporus DSM 41855 ECF41 ECF41s2

>ECFp10666 ECF41 ECF41s2 Streptomyces scabrisporus DSM 41855

1 MNEHDFLAERFEAHRGHLSAVAYRMLGSLTEADDALQETWLKLSRSDPDE
51 VDNLAGWLTTVVGRVCLDMLRSRRSRGEEPLDAQVHIPDPIIAGMPDADP
101 EHAVLLADSVGLALLVVLETLAPAERLAFVLHDLFAVPFDEIAPIVDRTP
151 AAARQLASRARRRVQGAAPSPDGDLAVQREVVDAFLTAARGGDFDALVAV
201 LDPDVVARADGGALRPSGVIRGAEQVAGQALTFARFAAVARPALVNGTAG
251 IVSVAAGQPMSVLAFTIVRRRIVTIDILADPQRLNRLDLTVLAS

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more