ECF proteins of ECF subgroup ECF41s2

Displaying ECF 201 - 220 of 1206 in total

>ECFp19506 ECF41 ECF41s2 Amycolatopsis keratiniphila

1 MDRLTERFEEHRTRLRAVAYRMLGSASEAEDAVQDTWLRLNRTDAAEIEN
51 LGGWLTTVVARVCLNVLRSRDHRREESLDDRLAEPADSSADPAADAVLAD
101 SVGLAMLVVLDTLAPAERLAFVLHDMFAVPFDEIAPLIDRTPAAARQLAS
151 RARRRVQGRSTAAEPDLARRRQVVDAYLTAARGGDFAALLELLHPDVVLR
201 ADKAAGPSREPIFLRGANVVARGAAAASVRAAVTQLALVNGGIGLVMADE
251 GRPSVVLAFEFVDGKISEIDVIADRERVRGLDLVMVD

>ECFp19549 ECF41 ECF41s2 Nocardia asiatica NBRC 100129

1 MHDEQFSADRFEAHRAHLRSVAYRMLGSLPDADDAVQEAWIRLARTDTSD
51 VANLGGWLTTVVGRVCLDMLRARRTRHEEPLEAEHLPDPVITSETTPDPE
101 HEALLADSVGLALLVVLESLRPAERLAFVLHDMFALPYEQIAPIVDRTPQ
151 TAKKLASQARRRVQGATPGPAPDLPRQRRVVDAFLTAARGGDFDELLRLL
201 DPDVVLRADAGAVMRVIRGASAVAGQAETFQRMATLCATHPALVNGGPGL
251 VNTLDGNPFSIIGFTVTDDHITAIDILSDRDRLTRLDLTAVLG

>ECFp11907 ECF41 ECF41s2 Streptomyces niveiscabiei

1 MDERDATAARFEAHRGHLRAVAFRMLGSLGDAEDAVQEAWLRLDRSAPEG
51 VNDLRAWLTRVVGRICLDMLRSRTARREVPTDRAVAETVTDDRAPDPEQE
101 AILVESVGRALLVVLDRLNPAERVAFVLHDLFAVKFDDIAPIVDRTPAAA
151 KKLASRARLRVHGATPPENDGVGLAEHRRVVESFLAAARGRDLAGLLAVL
201 DPDAVRRADALALPAGVPLEVRGARSIVEETLLLTRNALAADVVLVDGRI
251 GLAVAPRGRLRLVLTFVVRDGRIAEYQVTGDPAQLERLDLALPPCLRPDD
301 DRSRHAGRGRRTREPVQYARSH

Name Aliases LCA Taxa Group Subgroup
ECFp19899
  • DNA-directed RNA polymerase sigma-70 factor
  • MYCSM_RS23490
Mycobacterium sp. JS623 ECF41 ECF41s2

>ECFp19899 ECF41 ECF41s2 Mycobacterium sp. JS623

1 MTKGDTVPEERFEEHRRHLRAVAYRMLGSLAEADDAVQEAWLRMHRSDVT
51 DVRNMRGWLTTVVARICLDMLRARSARSEEPLDEAPAIAADAVDPEAEAV
101 LADSIGVALLVILQTLSPAERLAFVLHDMFELPYAEIAPIVGRTENTAAQ
151 LAARARRRVRGKTPDPAMDLVRQRRLVDAFLAAAHDGDFDALLSVLDADV
201 VLRVDAAAAGTPTTLRGAQTIATNARAFSANARFAEPALVDGAVGIVVAP
251 KGKLALVLRFAVAGDKITEIDIDADPQRLSAFELAVLD

>ECFp12524 ECF41 ECF41s2 Streptomyces

1 MSAVGETGEDKEDLARSFEEHRAHLKAVAYRMLGSLAEAEDAVQEAWLRL
51 GRVDPAEIGNLGGWLTTVTGRICLDLLRSRAARREQPMDDTFVPDPVIRP
101 LSRVDPEQEALEADSVGIALLVVMEALDPDERLAFVLHDMFAVPFDDIAP
151 VVERTPAATRQLASRARRRVRDSAPPAAPDAAQQRQALDAFRAAARTGDF
201 EALLAVLHPDVVLRADAGALLEGVAGSKRLQGAQRVAESAMLFARYNATA
251 RMVLVNGAPGLVSVVDDRVGSVLSVTVHEGRITALYILADPERLEGVALP
301 PEGEGAGED

Name Aliases LCA Taxa Group Subgroup
ECFp10641
Sorangium cellulosum ECF41 ECF41s2

>ECFp10641 ECF41 ECF41s2 Sorangium cellulosum

1 MDENCWLAERFEAHRAHLRAVAYRMLGSLGEAEDAVQESWLHLSRADTSG
51 VDNLGGWLTTVVARVCLDMLRSRKARREEPMAAPDPAADREAGTDPEREA
101 VLADSVGLALLVVLDTLTPAERLAFVLHDLFAVPFEEIASIVGRSPAAAR
151 QLASRARRRVQGAPPSPDADVGRQREVVDAFLAAMRGGDFDALVAILDPD
201 VVIRSDATAAPPAGKEVRGARAWAKQAIAGARGAKFARPALVDGTAGVVV
251 APHGRLFRVLRFTLAQGKIAQIDVLGDPEQLRDLDLSLLDDGPHPEPWRS
301 PV

>ECFp13132 ECF41 ECF41s2 Bradyrhizobium sp. Ai1a-2

1 MDEKNFLAEQFEANRGHLRAVAYRMLGSAGEVDDAVQETWLRLSRTDASA
51 VENLGGWLTTVIARVCLDMLRGRKARREEPMGPQVPEPAAHDTHERDAEM
101 ADSVGAALLVVLDALAPAERLAFVLHDMFAVPFEEIAPIVGRTPAAARQL
151 ASRARRRVQGSREAADGDAPRQRRIVEAFLAASRDGDFEGLLAVLDPDVV
201 FRADVAAQRLGSLAEIRGAPAVAETFKGRAQAATPALVDGRPALAVILDG
251 QLRIVLQFTIAGDRIAAFEAIADRERIAAFDVEVLPSN

>ECFp14875 ECF41 ECF41s2 Streptomyces sp. MBT76

1 MSEKDFLAERFEELRPHLRAVAYRMLGSLAEAEDVVQETWFKLSRSDTSE
51 VGNLGGWLTTVTGRVCLDMLRSRATRHEEPLHDRDGQVVRLPDPVISGAD
101 RIDPEQEILLADSVGIALMVVLQTLAPAERLAFVLHDMFHVPFDDIAEVI
151 DRTPAATRQLASRARRRVQGQAPAPDTDLAARRRVVEAFLAAARGGDFDA
201 LVAVLDPDIVARSDGGTLLPSALRRGATEVASQAIMFARFAEAALPALIN
251 GTPGVVAVTADGRPMSVMAFTIQGGRVTALDILTDPERLERIDVSALMK

Name Aliases LCA Taxa Group Subgroup
ECFp15205
  • RNA polymerase subunit sigma-70
  • Spa2297_29690
  • ... more
Streptomyces parvulus ECF41 ECF41s2

>ECFp15205 ECF41 ECF41s2 Streptomyces parvulus

1 MPGERGRRRLAERFEEHRGQLHAVAYRMLGSAAEAEDAVQEAWLRLDRAG
51 PDGIENLGAWLTTVTGRICLDLLRSRTARREEPMTEGFDTFVPDPVVRAL
101 PQADPEQEALRADSVGIALLVVLETLGPAERLAFVLHDMFAVPFDAIARI
151 VERSPAATRQLAGRARRRVRDATPAADPDLGRQRRAVEAFLAASRAGDFE
201 ALVSVLHPDVVLRADAGALGRGPAASKVVSGARTVATGAFHFRHLAGAAR
251 LVLVNGSVGTVAVTEGRPRSVTYVTVADGLITGLYILSDPERLARLDLSG
301 LAD

Name Aliases LCA Taxa Group Subgroup
ECFp15860
  • RNA polymerase sigma 70
  • IG86_RS0113160
Streptomyces virginiae ECF41 ECF41s2

>ECFp15860 ECF41 ECF41s2 Streptomyces virginiae

1 MTERFEEHRSHLRAVSYRMLGSLAEADDAVQEAWLRLRRSDVSEVENLGG
51 WLTTVVSRVCLNMLRSRETRREDSMDAYPAYPADPAVGREDTVDPEQEAV
101 MADSVGLALLVVLDTLTPAERLAFVLHDLFAVSFDEIAPLLGKSSAATRQ
151 LASRARRRVKGAPLVAEADLARRRRVVEAFLAATRGGHFDDLVSLLHPDV
201 VLRADKAVGPTPRPLVVTGAVPVATGAMAAMQRARATQPALVGGTVGLAM
251 APLGRLFLVLRFTIEDGLITEIDVVAEPERLAELELAVLD

Name Aliases LCA Taxa Group Subgroup
ECFp15920
  • RNA polymerase sigma 70
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Frankia inefficax ECF41 ECF41s2

>ECFp15920 ECF41 ECF41s2 Frankia inefficax

1 MPDHDRPHTSPTSPLPPEPGPGEPGRGEAGGGEWLAGRFEEHRAYLRSVA
51 YRMLGSRAEADDAVQEAWLRLARSDAGAIENLRAWLTTVVGRVCLNALRA
101 RAARREEPAELTLADPVVSRPDEAPGPEEQALLADAVGVALLVVLDTLDP
151 PERLAFVLHDLFAVPFDEIAPMVGRSPQAARQLASRARRRVRGAAGDARG
201 DGGDGVVAGDDARRRAVVEAFFAAARGGDLDGLLALLAPDAVLRADVGAA
251 TGAPAAAGGVRHGADAIARQALRFANPRSTLHPVLVNGTTGVVVTVGGEP
301 AAVMAFTVLAGQIVAIDAWSGPDRLRSVDLGALTR

>ECFp17391 ECF41 ECF41s2 Streptomyces roseochromogenus subsp. oscitans DS 12.976

1 MDDFTEDAGRRLAARFEADRSHLTAVAHRLLGSATEADDALQEAWLRARE
51 ADLDEVRNLTGWLTTVVTRVCLNLLRARRNRREEFLDAQDARNARDDRDA
101 RDTVHDTPAFSAEAGDPAREALLADEVGVALLVVLDTLSPAERVAFVLHD
151 MFAVPFEEIAPLVERTPAATRQLASRARRRVQGRTPAPAADAVRRRRAVE
201 AFLAATRGGDFTALVALLDPDVVLHADALVVPTPAPITVRGAEPVARGAM
251 AAMARAQVTGLALLDGEFGLVMAPYGRPRLVLAFAFGTDGRITRIDVVAE
301 PERLRGTEIAVVDPAQTGTGGPGKVDH

>ECFp12694 ECF41 ECF41s2 Rhodococcus sp. UNC363MFTsu5.1

1 MDENDWLALRFEEHRTHLRAVGYRMLGSLSDADDAIQETWLRLSRSEADS
51 LTNLGGWLTTVMGRVCLDMLRSRKVRREDSIDDQQLPDPIVGVVEGTNPE
101 HEALLGDSVGLALLVVLDTLTPAERLAFVLHDMFAVPFDEVAAVVGKSTA
151 TTRQLASRARRRVQDSTPVPDPDLVRQREVVDAFLAASRGGDFDALVAVL
201 DPDVVLRADTGAGFLKVVRGAEAVSAQALSFARFAHSSMPALVNGAVGMV
251 NAPDGRLQSVMAVTITNGLIVEIHILADRPRLERLDREAARG

>ECFp19122 ECF41 ECF41s2 Streptomyces

1 MAERFEEHRAHLRAVAYRMLGSLSEADDAVQESWLRLSRSDVSGVGNLGG
51 WLTTVVGRVCLDMLRSRTARGEESLDVRVPDPVVGGGADGIDPEHQALLA
101 DSVGLALLVVLQTLAPAERLAFVLHDMFAVAFEEIGPVVGRTPAAARQLA
151 SRARRRVRGTATPDTDLARQREVVDAFMAASRGGDFEALVAVLDPDVVLR
201 ADTGAGFPGLAATARGAREVAGRAFMFRRFAHFARPALVNGAMGIVTVAD
251 RGPVSVMGLTIAGGKIVAIDILADPERLRGLGLGLEVEREGRG

>ECFp14663 ECF41 ECF41s2 Rhodococcus

1 MDDCDRLTERFEEHRPRLRAVAYRMLGSVTEADDAVQEAWLRMNRADTGD
51 VDNLEAWLTTVVSRVCLNVLRSREQRREEPLDVQAHDPVVGHEDGGDPEH
101 EAVLADSVGLALLVVLDTLTPAERLAFVLHDMFDVPFDDVAPIVGRSSPA
151 VRQLASRARRRVKGVSPAPATADLERQRRVVDAYLAATRGGDFDALVALL
201 DPDVVLRADPAVGPTPAPLVIRGARVVARGALASSERARFTQVALVNGAV
251 GLVMALRGRLHLVLKFTIADGSITEIDVIAEPDRVRRLDLAVLGD

Name Aliases LCA Taxa Group Subgroup
ECFp19968
  • RNA polymerase sigma 70
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Streptomyces ECF41 ECF41s2

>ECFp19968 ECF41 ECF41s2 Streptomyces

1 MSDGDQHRHGDQHREDFLAERFEEYRGHLRAVAHRMLGSVAEAEDAVQEA
51 WFRLSRSDTREVQNLAGWLTTVVGRVCLDMLRSRRSRGEQPLDTWSPAPS
101 AEPDPAQDALRADSVGSALLVVLETLSPAERLAFVLHDLFGVPFEEIGGI
151 LGRSPAAARQLASRARRRVRGADAPEADLVRQREVVDAFLAAARDGDFDG
201 LLAVLDPEVVARGEAGVTIGATDVAATAASFGHLAGVALPALVDGATALV
251 VLTDGRPERVLTFTFAADRIAGIDVVTDPARLAELSIEPA

Name Aliases LCA Taxa Group Subgroup
ECFp12144
  • DNA-directed RNA polymerase sigma-70 factor
  • ON39_RS22660
Nocardia tenerifensis NBRC 101015 ECF41 ECF41s2

>ECFp12144 ECF41 ECF41s2 Nocardia tenerifensis NBRC 101015

1 MDEYLADRFEEHRAHLIAVAYRMLGSLAEAEDAVQEAWLRLARTDQDGID
51 NLGGWLTTAVSRVCLDLLRSRRARREDSFEEQLPDPVVRLDDGTDPEQQA
101 VLADSVGLALLVVLDSLNPAERLAFVLHDMFAMPFDQIAPILGKSSGAAK
151 MIASRARRRVQGETPRLDPDLPRQRRAVAAFLAAARDGSFDALLSILDPD
201 VMLRSDSGVGGVQIIRGATAVAGLLDTFHKFAIMYDITPAVVNGVAGLLN
251 TADGRPMSIIAFTVADDKITAIDLLADPARLAALPLPAR

Name Aliases LCA Taxa Group Subgroup
ECFp14250
  • DNA-directed RNA polymerase sigma-70 factor
  • EX05_RS02445
Agrobacterium rhizogenes ECF41 ECF41s2

>ECFp14250 ECF41 ECF41s2 Agrobacterium rhizogenes

1 MDEKKWQAEKFEANRPHLRAVAYRMLGSRTEAEDAVQEAWLRLVRGDTSD
51 VENLSGWLTTVTARICLDLLRARKSRREEPLTVLIPEPAVTHEAEQDALL
101 ADSVGLALLVVLEKLNPAERLAFVLHDMFDVSFDDIAPIVGRTTVATRQL
151 ASRARRRVQETPVAMEADLTRQRHVVDAFFAASRGGDMHALLAVLAPEAV
201 FRPDAVAARMGSVGEIRGRVDVAKTFNGRAQAARPAVISGAVGAIVVIGG
251 QLRIALHFTVNEDGMVATIDAMADPEQLRKLDIVLIEP

>ECFp10912 ECF41 ECF41s2 Bradyrhizobium pachyrhizi

1 MDEKNSLTEQFEANRPRLRAVAYRMLGSTAEVDDAVQETWLRLGRTDTAA
51 VDNLGGWLTTVIARICLDMLRSRKSRREEPIGPHVPEPIADNPSERETEM
101 ADSVGAALLVVLETLAPAERLAFVLHDMFAVPFEEIAPIVGRTPAAARQL
151 ASRARRRVQGTPPAPDADLSRQRGIVEAFLAASRNGDFEGLLAVLAPDVV
201 VRADQAAQRLGSLPVIRGAAAVAESFRGRAQAARPALVDGGIGVAVIFGG
251 ALRVVLQVTISGDRIAAIDATADVSEIETFDVEVLERS

>ECFp10867 ECF41 ECF41s2 Streptomyces griseoruber

1 MTDTDVLAQRFEEYRAHLKAVAYRMLGSLAEAEDAVQETWLRLGRSDVDE
51 VRNLGGWLTTVTGRVCLDLLRSRTARRELPMDEGYEGYAAFVPDPVIAPL
101 SRTDPEQEVLQADAVGLALLIVLETLEPDERLAFVLHDMFAVPFDDIAPI
151 VERTPAATRQLASRARRRVQGATPSAEPDLGRQREVVSAFLAAARAGDFE
201 ALVSVLHPDVVLRADSGALVRGAAASKIVHGAKAVAEQAVLFRQFAPAGR
251 LALVGGAVGILNGPEGEVRSVMGITVADGRIVALHILADPERVAALDVPE
301 GL

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more