ECF proteins of ECF subgroup ECF41s2

Displaying ECF 181 - 200 of 1206 in total
Name Aliases LCA Taxa Group Subgroup
ECFp17902
Rhodococcus sp. WB1 ECF41 ECF41s2

>ECFp17902 ECF41 ECF41s2 Rhodococcus sp. WB1

1 MSDGYFSAHPGGAFPAEQFEAHRDHLRAVAFRMLGSASEADDAVQEAWLR
51 LHRSGTDEVANLGGWLTTVVSRVCLDMLRSRGSRREVPLDQPDRPEPGST
101 DPRDVPESAALLADSVGVAMLVVLDTLAPAERLAFVLHDLFAVPFDEIAP
151 IVERSPAATRQLASRARRRIQGATAPRADLMRRRRLVDAFLAASREGRFD
201 DLLALLDPDVVLRADDVAVATARAGAAHGAPALAHELHGPHSVAKVFDGR
251 AQAARTVLVDGMPGAAWAPGGRPRTVFAFTIEDDAIVEIEVVSDPGQLAA
301 LEVTFPDAG

>ECFp17907 ECF41 ECF41s2 Rhizobium leguminosarum bv. viciae 3841

1 MDEKKWLADEFEANRAHLRAAAYRMLGSRSEAEDAVQEAWLRLSRTDTTG
51 VGNLGGWLTTVVARICLDMLRARKTRREEPLEAPIHAGIADPANDPEREA
101 AFADSVGLALLVVLQTLAPAERVAFVLHDMFDLPFDEIAPIIGRSSAATR
151 QLASRARRRVQGVDEAPDVDFGRKRTIAEAFLTASRNGDLERLIAVLAPD
201 VVFRPDATAARFGTIGEMRGAAHVAEAFKGRAQAAEIAIVGGELGFVVEI
251 QGQLRVVVALTIADGRIAAIDAIADPDHLERLDYSILLD

Name Aliases LCA Taxa Group Subgroup
ECFp1795
  • RNA polymerase, sigma subunit, ECF family
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Frankia ECF41 ECF41s2

>ECFp1795 ECF41 ECF41s2 Frankia

1 MEDATWQAEQFERQRPRLQAVAYRMLGSLSEAEDAVQEAWLRLSRSGDEA
51 INNLGGWLTTVVGRVCIDMLRARQARREDFVGTWLPEPIVSAEDGDGPEQ
101 QTVLADSVGLALLVVLETLTPSERLAFVLHDMFAVPFEEIAPIVDRTPAA
151 ARQLASRARRRVRGAPTVPDPDLAAQRKVVAAFLAAARAGDFDALVAVLD
201 PDVVFRVDTGSRTRLMPTLLTGSADVAQHTAIQGPRFARHCQPALVNGTA
251 GIVARTSTGVIAVAGLTVRDGRIATIDLILDPDKLHRLVLAD

Name Aliases LCA Taxa Group Subgroup
ECFp17968
Rhodococcus sp. JVH1 ECF41 ECF41s2

>ECFp17968 ECF41 ECF41s2 Rhodococcus sp. JVH1

1 MDDRDRLTERFEEHRPRLRAVAYRMLGSVSEADDAVQEAWLRTSRADTDD
51 VDNLEAWLITVVSRVCLNVLRSREQRREEPLDVQAHDPVVGHGDGGDPEH
101 EAMLADSVGLALLVVLDTLTPAERLAFVLHDMFDVPFDDVAPVVGRSSPA
151 VRQLASRARRRVKGASPAPDTADLDRQRRVVDAYLAATRGGDFDALVALL
201 DPDVVLRADPAVGPTPAPLLIRGARVVARGALASSERARSTQVALVNGAA
251 GLVMALHGRLHLVLAFTIADGRITEIDVIAEPDRVRRLDLAVLDD

>ECFp18008 ECF41 ECF41s2 Streptomyces sp. NRRL S-241

1 MDGNAWLTERFEEHRSHLRAVSYRMLGSLAEADDAVQETWLRLSRSDISE
51 VENLGGWLTTVVSRVCLNMLRSRASRREDSMDAYPTDPAGSREDTVDPEQ
101 EAVMADSVGLALLVVLDRLAPAERLAFVLHDLFAVPFDEIAPMIEKTPAA
151 TRQLASRARRRVKGAPLVPEADLSRRRHVVEAFLAATRGGNFDALVTLLH
201 PDVVLRADTAVVPTPAPILLRGAVTVATSAMAAMQRARATAPALVDGTVG
251 LAMAPLGRLFLVLGFTIEDGLITEIDIVAEPERLGALELAALDV

>ECFp18082 ECF41 ECF41s2 Streptomyces sp. TOR3209

1 MNPPENLAERFEEHRPRLKAVAYRMLGSLTEAEDAVQEAWLRLSGADGRR
51 IDNLGGWLTTVVGRVCLDLLRTRKRRGEEPLEDRLPDPVIGREDRADPEH
101 QALVADSVGLALLVVLDSLNPAERLAFVLHDMFGLSFEEIAPIVDRTPQA
151 ARKLASRARLRVRGATPPPDPDRSGQRRVVDAFLAAARGGDFDGLVALLD
201 PEVTLRADGGALTGGLRTIRGAAAVAGQLDTFRRMATAAATHPALVNGAA
251 GLVNTMDGRPFSVMGFTVSGGRIAAIDILSDPARLAGLDLASVEG

>ECFp15693 ECF41 ECF41s2 Streptomyces sp. NRRL F-4707

1 MTTGERDVRGTRDVRGERDVRGQQRLAERFEEHRGQLKAVAYRMLGSLAE
51 AEDAVQEAWLRLDRAGGDGVANLGAWLTTVTGRICLDLLRSRTARREEPM
101 SEGFDTFVPDPVVSALPRTDPEQEALHTDSVGIALLVVLETLEPAERLAF
151 VLHDMFAVPFDDIAPVVERSPAATRQLASRARRRVREATPAAEPDLGRQR
201 QAVEAFLAASRAGDFEALVAVLHPDVVLRADAGALARGVAASKVVRGART
251 VATGAFHFRHLAGLARVVLVNGAVGTVAVSEGQPRSVTCVTVADGLITGL
301 YILSDPERLARLDLSALEV

Name Aliases LCA Taxa Group Subgroup
ECFp18222
Rhizobium acidisoli ECF41 ECF41s2

>ECFp18222 ECF41 ECF41s2 Rhizobium acidisoli

1 MNEKKWLADQFEANRAHLRAAAYRMLGSRSEAEDAVQEAWLRLNRADTTD
51 VGNLGGWLTTVVARICLDMLRARKTRREQPLEMPVHAAIADPAHDPERDA
101 AFAESVGVALLVVLQTLAPAERVAFVLHDMFDLPFDEIAPIIGRSSAAAR
151 QLASRARRRVQGTDEAPDVDFGRKRTIAEAFLTASRNGDLEALLAVLSPD
201 VVFRPDATAARFGPFGGRRGASEVAELFKGRAQAAEAALVDGEVGFIVRI
251 KDELRVVVTLTIADGKVTVIDAFADPDYLEHVDYSVLSS

>ECFp18302 ECF41 ECF41s2 Streptomyces caeruleatus

1 MNDTELLADRFQEHRGRLKAVAYRMLGSLAEAEDAVQEAWLKLSRSDAHD
51 IENLGGWLTTVVGRVCLDLLRSRTRRHEEPLDDTFVPDPVIRPLSTVDPE
101 QEVLQADSVGLALLVVLEALEPAERIAFVLHDMFAVPFDDIAPIVERSSA
151 ATRQLASRARRRVKGATPSAETDPGRQRQVLDAFMAASRAGDFEALLAVL
201 DPGIVLRVDSGPLVGGAAASKVVRGAQPVAEQAMLFRQFARYMQLVSVNG
251 TVGVLNAPEGRPQSVMGVTVVDGRITEMYILADPERLAALDLPDLTG

>ECFp18342 ECF41 ECF41s2 Streptomyces sparsogenes

1 MHAQDEPADGPADELALGLADRFEAHRDRLRSVAHRMLGSFSEAEDAVQE
51 AWLRLTRGGTDDVENLGGWLTTVVSRICLDMLRSRASRREDLAGHPVPDE
101 TPDPDRGGDPEQEALLVDSVGRALLVVLDRLGPAERAAFVLHDMFAVPFD
151 EIAPIVDRSPATTKKLASRARQKVRGAAPTLPGTELARQRRVVEAFLTAS
201 RAGDIDGVLAVLAPDVVRRADRAAVPPDRPGEIRGARAVAEEIAAFGRNS
251 RFAEPALVGGRVGIVVAPQGRLRLVVAVTVVGERITAYELIADPARLHRL
301 DLAVLDAVLPLGG

>ECFp18400 ECF41 ECF41s2 Micromonospora sp. NBRC 110037

1 MDHGLAQRFERERPRLRAVAYRLLGSLTDAEDAVQETWLRLARTDPAAVD
51 NLDAWLTTVVARVSLNALRSRAARREDPLDVRLPDPVVDADDPAHAAVLA
101 DSVGLALLVVLDTLSPAERLAFVLHDMFGVPFDEIGPLVDRSPAAARQLA
151 SRARRRVRGQAPTPDPDLTRQRAVVDAFLAAARDGDLDALIAVLHPDVVL
201 RSDAGTARARHTVVLTGATTVAAQATTFGRLFPHARPVLVNGAAGVLVSA
251 GDRPLSVMAFTVTGGRIAAVDVIADPRRLAALGLTG

>ECFp18481 ECF41 ECF41s2 Streptomyces

1 MTGSEELADRFEEHRGHLKAVAYRMLGSLSEAEDAVQEAWLKLGRTDADD
51 IHNLGGWLTTVTGRVCLDLLRSRTARREQPMGDTQDTVRAFVPDPVLRPL
101 SHLDPAEEVLQADSVGLALLVVLENLAPDERLAFVLHDMFAVPFDDIAPI
151 VERSPAATRQLASRARRRVRGATPSAEPDLGRQKQVLDAFLAASRGGDFE
201 ALLALLHPDVVLRADSGALVRGTAASKVVQGAKAVAEQALMFARYAQAAQ
251 LVLVNGSVGVVHMPGGRVQSVMGVTITDGRITGMYILADPERLGRLAAPG
301 VTE

Name Aliases LCA Taxa Group Subgroup
ECFp18484
  • hypothetical protein
  • RNA polymerase sigma 70
  • ... more
Intrasporangium oryzae NRRL B-24470 ECF41 ECF41s2

>ECFp18484 ECF41 ECF41s2 Intrasporangium oryzae NRRL B-24470

1 MDDKTPHSEPDPGPLDDGEWLAQAFESHRGHLRAVAHRMLGSATDADDAV
51 QEAWLRLSRSDPSEVVNLGGWLTTVVARVSLDMLRSRASRREDPWDAELA
101 ALSGDDRRPGGTTVADPAAEAELADSVGVALLVVLDTLAPAERLAFVLHD
151 LFGVPFEEIAPIVDRSPAAARQLASRARRRVRASDGDGAARTETSEAEVG
201 SDAPASREVVAAFLAASRGGDLGRLLELLAPDVVVRADAAAVAMGSVPLT
251 EGAEAVAQTFVGRARGARLALLDGSPGALWSVGGTPKVAFAFTVDHGLIV
301 AVDLLADPDRLAALEVAYLRD

>ECFp18514 ECF41 ECF41s2 Rhizobium leguminosarum bv. viciae UPM1131

1 MDEKKWLADEFEANRAHLRAAAYRMLGSRSEAEDAVQEAWLRLSRTDTTG
51 VDNLGGWLTTVVARICLDMLRARKTRREEPLEAPIHAGIADPANDPEREA
101 AFADSVGLALLVVLQTLAPAERVAFVLHDMFDLSFDEIAPIIGRSSGATR
151 QLESRARRRVQGVDEAPDVDFGRKRTIAEAFLTASRNGDLEGLIAVLAPD
201 VVFRPDATAARFGTIGEMRGAAHVAEAFKGRAQAAEIAIVGGELGFVVEI
251 NGQLRVVVALTIADGRIAAIDAIADPDHLERFDYSILRD

Name Aliases LCA Taxa Group Subgroup
ECFp18698
  • RNA polymerase sigma 70
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Streptomyces sp. 150FB ECF41 ECF41s2

>ECFp18698 ECF41 ECF41s2 Streptomyces sp. 150FB

1 MYEQDGPGGHDALAERFEAHRGRLRGVAYRMLGSASEADDAVQEAWLKLS
51 RVDPGGIGNLTGWLTTVVSRVCLDMLRSRRSRPEEPIGQRMPDDIGAEAV
101 DGGGPEDEAVLIESVGRALLVVLDRLGPAERIAFVLHDMFAVPFDEIAPI
151 VDRTPVATKKLASRARLRVRGNPVVPGPELDRHREVVEAFLAAARGGDLD
201 ALLGVLAPDVVRRSDPAAVPPGAAAEARGARTVARETVILAGRAQAAALA
251 LVNGTVGIVVAPGGRLVIALLLTVEDDRIAEYEVIADPARLRALDVAVLG
301 D

Name Aliases LCA Taxa Group Subgroup
ECFp18747
  • RNA polymerase sigma factor, sigma-70 family
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Saccharomonospora marina XMU15 ECF41 ECF41s2

>ECFp18747 ECF41 ECF41s2 Saccharomonospora marina XMU15

1 MQDEEFWAARFEEHRPRLRALAYRMLGSFAEADDAVQEAWLRVSRARGDD
51 VDNVGGWLTTIVSRQCLNMLRSRASRREDPLDVRVPDPVVQSGEGDPEEH
101 GVLADTVSLALLVVLETLDPAERLAFVLHDMFAVPFDDIAPMVGRTPAAA
151 RQLASRARRRVQGAATAGQPDRARQRQIVDAWWAAARGGDFAGLVALLHP
201 DAVLRVDTGGAGSKLVRGAAEVAGQAASYRAAGLAARFAVVNGGPGIVSM
251 IGGRPAAVLAFTVVDGLIAEIDILADRRRLAALELAC

>ECFp1880 ECF41 ECF41s2 Caulobacter segnis ATCC 21756

1 MPPENYLAERFEADRARLRGVAYRMLGSLPEAEDAVQEAWLRLSRTGADG
51 VDNLSAWLTTVTSRVCLDMLRGRKARREDAIDEGAPEPSVAAEDVVERET
101 ILADSVGLALLVVLRSLTPAERIAFVLHDLFDMPFEQIAPIVERTPEAAR
151 QLASRARRRVRGGEALEATQTAQKSVVDAFLLASRTGDLAGLMAVLAPDV
201 VVRSDVLGGGGQVRELRGAEKVANFYNGLAQTARTALVDGAIGAVVAPRG
251 QLARVLDIRVENGRIVEIFVAGDPERLETVEVALV

Name Aliases LCA Taxa Group Subgroup
ECFp18833
  • DNA-directed RNA polymerase sigma-70 factor
  • K340_RS0104435
Nakamurella lactea DSM 19367 ECF41 ECF41s2

>ECFp18833 ECF41 ECF41s2 Nakamurella lactea DSM 19367

1 MNDSEWLAERFEEQRAHLRSVAYRMLGSVNEADDAVQEAWLRLHRTDVDG
51 VQNLTAWLTTVVARIALNMLRSRQNRREDPFDVHVPEPIVSPESGVDPEH
101 EALLSDSVGLALLVVLEALTPAERLSFVLHDMFAVPFDEIGPMIDRSPAA
151 ARQLASRARRRVQGQPTAPDPDVVKQREVVSAFFAASKDGDFDGLVAVLH
201 PEVILRSDGGAARPKMTFTLHGAQDVAKQAFTSSRLSPFVHPALINGAAG
251 VVVAAHGKTMFVMAFTVTDSKIVAIDVLADPDRLREVDVSAL

>ECFp18843 ECF41 ECF41s2 Caulobacter

1 MPPKNPEKNYLADKFEADRSRLRGVAYRMLGSLPEAEDAVQEAWLRLSRA
51 DTSGVDNLSAWLTTVTSRVCLDMLRSKKSRREDALLEGGPEPSVSGEEAI
101 ERETILADSVGLALLVVLQALSPAERIAFVLHDLFDMPFDEIAPIVERTP
151 DAARQLASRARRRVRGGEAPLDAAQTAKKSVVDAFLTASRTGDMQGLLAV
201 LDPNVVVRADVFAGGGQTRELRGREKVAAYYDGLAQTARTALVDGEIGAV
251 VAPRGKLYLVLDIKVENGKVVEITAVGDPERLATLELGVTDL

>ECFp19432 ECF41 ECF41s2 Streptomyces sp. 303MFCol5.2

1 MTTYTALPPERFEADRPHLRAVAYRMLGSLGEAEDAVQETWLRAARADVG
51 EVDNLSGWLTTVVGRVCLNMLRSRRTHPEVPLDARVSEPAAGTARGGDPE
101 EEALLADSVGVALLVVLDTLAPAERLAFVLHDLFAVPFDTIAPMIERTPA
151 TTRQLASRARRRVKGGAPAAVADRARQRRVADAFLAATRGGDFEALLALL
201 HPDVVLTADRFVVPTPEPVTVSGARPVAEGAMAATGRARFTGLALLDGRV
251 GLAMAPHGRLRLVLLFTLAEDAITRIDVVADRERLDDIEVAVLDTPGAEA
301 VGTEAVGAGPVDTAPGSAEG

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more