ECF proteins of ECF subgroup ECF41s2

Displaying ECF 1 - 20 of 1206 in total
Name Aliases LCA Taxa Group Subgroup
ECFp10365
Devosia sp. Root413D1 ECF41 ECF41s2

>ECFp10365 ECF41 ECF41s2 Devosia sp. Root413D1

1 MDDEKILASRFETDRRHLKRVAYRMLGSMTEAEDAVQEAWLRLSRSDTGT
51 VGNLSGWLTTVVARVCLDMLRARKARREEPLEQPAAEALADADDPERTLE
101 MADSLGVALLVVLETLPPPERVAFVLHDMFDLPFEEIAPIVGRSTDAARQ
151 LASRARRRVKGGSDTIEPSRERHRTVVEAYLRASRSGDLAALLAVLDPEV
201 VLRADASAVPAGVALVARGAEVVARRALTGFMPEAQLALVNGAMAVVVLR
251 DGAPFRVLRFTVSGERVTEIEVLADTDRLAGLAVVPA

Name Aliases LCA Taxa Group Subgroup
ECFp16551
  • DNA-directed RNA polymerase sigma-70 factor
  • A3CU_RS0109270
Amycolatopsis taiwanensis DSM 45107 ECF41 ECF41s2

>ECFp16551 ECF41 ECF41s2 Amycolatopsis taiwanensis DSM 45107

1 MKRDDGLAARFDAHRDHLRTVAYRILGSLSEAEDAVQEAWLRLMRVDANS
51 INNLGGWLTTVVSRVCLDMLRARESRREELAGHQVSDQSPDPAPAGDPAQ
101 EALLADSVGRALLVVLDRLGPAERIAFVLHDMFAVPFDEIAPIVDRSTVT
151 TKKLASRARQKVRGTPSVPGVELARQRHVIEAFLAASRAGDVDAVLAVLV
201 PDVVRRADQAALPTGRATEVRGARAVAEEIVVFGRNAQFAEPALVNGVVG
251 IVVAPRARLALVLTVTVEGERIAGYELVADPIRLQELDLAVLDR

>ECFp10581 ECF41 ECF41s2 Streptomyces violaceoruber

1 MRGQGDMRGERDVRGEQDVRRQRDARGQQRLAERFEEHRGQLKAVAYRML
51 GSLAEAEDAVQEAWLRLDRSEADGIDNLGAWLTTVTGRICLDLLRSRTAR
101 REEPMTEGFDSFVPDPVLRALPRADPEAEALHTDSVGIALLVVLERLEPA
151 ERLAFVLHDMFAVPFDDIAAVVERSPAATRQLASRARRRVRDATPAAEPD
201 LGRQRRVVEAFLAASRAGDFEALVSVLHPDVVLRADAGALARGVAASKVV
251 RGARTVATGAFHFRHLAPLARVVLVNDAVGTVAVSDGRPVSVTYVTVTDG
301 LITGLYILSDPERLAGLDVSGLEA

>ECFp10583 ECF41 ECF41s2 Rhizobium leguminosarum

1 MDEKKWLTEEFEANRAHLRAAAYRMLGSRSEAEDAVQEAWLRLSRTDTTG
51 VGNLGGWLTTVVARICLDMLRTRKTRREESLEAPVHGGIADPANDPEREA
101 AFADSVGLALLVVLQTLAPAERVAFVLHDMFDLPFDEIAPIIGRSSGATR
151 QLASRARRRVQGVDEAPDVDFGRKRTIAEAFLTASRNGDLEGLIAVLAPD
201 VVFRPDATAARFGTIGEMRGAAHVAEAFKGRALAAEIAIVGGELGFVVEI
251 QGQLRVVVALTIADGRIAAIDAIADPNHLERLDYSILLD

>ECFp10678 ECF41 ECF41s2 Streptomyces

1 MRGQQRLAERFEEHRGQLKAVAYRMLGSLAEAEDAVQEAWLRLDRAGGDG
51 VANLGAWLTTVTGRICLDLLRSRTARREEPMSEGFDTFVPDPVVSALPRT
101 DPEQEALHTDSVGIALLVVLETLEPAERLAFVLHDMFAVPFDDIAPVVER
151 SPAATRQLASRARRRVREATPAAEPDLGRQRQAVEAFLAASRAGDFEALV
201 AVLHPDVVLRADAGALARGVAASKVVRGARTVATGAFHFRHLAGLARVVL
251 VNGAVGTVAVSEGQPRSVTCVTVADGLITGLYILSDPERLARLDLSALEV

>ECFp10690 ECF41 ECF41s2 Streptomyces sp. NRRL B-5680

1 MPGASRERSGDTVNETVDERSGRTALFEEHRPHLRAVAYRMLGSISEAED
51 ALQDAWLRYDRTDTGAVGNLGGWLTTVVSRVCLNQLRDRAARREEPLQPT
101 GPDGAGGPERIPDPLLRREGVVDPEQEVMLADSVGLALMVVMESLSPAER
151 VAFVLHDLFAVPFEEIAPLIEKTAAATRQLASRARRKVQGQAPAPDPDLG
201 RQRRAVDAFFAAARNGDLDALLAVLDPDVVLRSDGGVGQARHTVVLNGAA
251 TVAEQAVLWGKLSPFARPALVNGTAGAVVIGDNGRALSIMAFTVVDGAIA
301 AIDVIVDQERLASFDLSAFRD

>ECFp10936 ECF41 ECF41s2 Rhizobium leguminosarum

1 MDEKKWLTEEFEANRAHLRAAAYRMLGSRSEAEDAVQEAWLRLGRTDTTG
51 VGNLGGWLTTVVARICLDMLRARKTRREEPLEAPVHAGIADPANDPEREA
101 AFADSVGLALLVVLQTLAPAERVAFVLHDMFDLPFDEIAPIIGRSSAATR
151 QLASRARRRVQGVDEAPDVDFGRKRTIAEAFLTASRNGDLEGLIAVLAPD
201 VVFRPDATAARFGTIGEMRGATDVAEAFKGRAQAAEIAIVGGELGFVVEI
251 QGQLRVVVALTIADGRIAAIDAIADPEHLERLDYSILGD

Name Aliases LCA Taxa Group Subgroup
ECFp10754
Streptomyces regalis ECF41 ECF41s2

>ECFp10754 ECF41 ECF41s2 Streptomyces regalis

1 MNDTELLADRFEEHRGHLKAVAYRMLGSLAEAEDAVQEAWLKLSRSDAGD
51 IENLGGWLTTVVGRVCLDMLRSRTRRHEEPLDDTFVPDPVIRPLSTIDPE
101 QEVLQADSVGLALLVVLETLEPAERIAFVLHDMFAVPFDDIAPIVERSSA
151 ATRQLASRARRRVRGATPSAEPDLGRQRQVLDAFMAASRAGDFEALLAVL
201 DPDVVLRADSGPLVRGVAASKVVRGAKPVAEQALLFRQFAQDTQLALVLV
251 NGTVGVLNAPEGKPQSVMGVTIADGRITEMYILADPERLGRLDLTGLDD

>ECFp11002 ECF41 ECF41s2 Streptomyces sp. NRRL WC-3795

1 MNPPENLAERFEEHRPRLKAVAYRMLGSLTEAEDAVQEAWLRLSGADGRR
51 IDNLGGWLTTVVGRVCLDLLRTRKRRGEEPLEDRLPDPVIGREDRADPEH
101 QALVADSVGLALLVVLDSLNPAERLAFVLHDMFGLSFEEIAPIVDRTPQA
151 ARKLASRARLRVRGATPPPDPDRSGQRRVVDAFLAAARGGDFDGLVALLD
201 PEVTLRADGGALTGGLRTIRGAAAVAGQLDTFRRMATAAATHPALVNGAA
251 GLVNTMDGQPFSVMGFTVSGGRIAAIDILSDPARLAGLDLASVEG

>ECFp11025 ECF41 ECF41s2 Rhizobium sp. Root1220

1 MDERNWLAAEFEANRGHLRGVAYRMLGSRAEADDAVQEAWLRLGRSEADA
51 IGNIGGWLTTVVARICLDVLRSRKSRREDPLDLPVHGGIADTATTADPER
101 ELVFADTVGVALLVVLQQLAPAERVAFVLHDMFDLPFDDIAPIIQRSSAA
151 TRQLASRARRRVQGKGEAPEADATRKRKLASAFLAASRTGDLRALLAVLD
201 PQVVFTPDATAISLGAVGELRGAEAVAETFKGRAQGARPALVDGEICFVV
251 AIRGELRVVLMLAFDGDRISAIDAIADPDRLNKLQYTLLEK

>ECFp11064 ECF41 ECF41s2 Amycolatopsis rifamycinica

1 MNDELLARSFETHRDHLRSVAYRMLGSLAEAEDAVQEAWLKLSRADTAAV
51 GNLAGWLTTVVGRVCLDMLRSRKARREEPWDVLVPDPIVSREDDGPEHEA
101 LMADSVGLALLVVLDTLTPAERLAFVLRDMFAMPFEEIASVVGRSEAATR
151 QLASRARRRVQGAPVAPDPDLARQRRVVDAFLAAARGGDFDALVSVLDPE
201 VVLRADRGAAQGGSTEVRGAAAVANQALTFSRLNAGGGVVHRALVNGAAG
251 VVATRDGRPFSVLGFTVAGGRIVEIDILADPGRLDRLDLAVID

>ECFp11096 ECF41 ECF41s2 Rhizobium mongolense USDA 1844

1 MDEKKILAGEFEANRAHLKTVAYRMLGSRAEAEDAVQEAWLRLGRADTSE
51 VGNLGGWLTTVVARICLDMLRSRKSRREEPLDPPVHEKIADTAKSADPEQ
101 EIVLADSVGVALLVVLEQLAPAERVAFVLHDMFDLHFDEIAPVISRTPEA
151 TRQLASRARRRVQGTTEAPEAGIEHRKEVVRAFLAASRDGNFQALLAVLH
201 PDVVFAPDATAARFGHAGALRGAQAVATTFNGRARGALPAFVDGGFGFIV
251 RIEDQLRIVVKIGFDGEKIATIEAIADPDQIERIKYRLFDR

Name Aliases LCA Taxa Group Subgroup
ECFp11117
  • RNA polymerase sigma factor
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Bradyrhizobium japonicum ECF41 ECF41s2

>ECFp11117 ECF41 ECF41s2 Bradyrhizobium japonicum

1 MSEENFLSHQFEASRDHLRAVAYRMLGSSAEVDDAVQEAWLRVSRYDTSD
51 VANLRGWLTTVVARICLDMLRARKSRREDPMGPHVPEPVDETREREAEMA
101 DSVGAALLVVLETLQPAERLAFVLHDMFAVPFEEIAPIVGRSVDASRQLA
151 SRARRRVQGAPVPETDVSHQRAIVDAFLKASREGNFEGLLALLDPDVVFR
201 ADQAAVRLGTLPEIRGADAVAQLYKGRAQAARTALVDGEIGVAVILGGHL
251 RIALRVTFNGDRIAGIEALADADRIATMEVEVLER

Name Aliases LCA Taxa Group Subgroup
ECFp11151
Rhizobium aegyptiacum ECF41 ECF41s2

>ECFp11151 ECF41 ECF41s2 Rhizobium aegyptiacum

1 MDEKKWLADEFEANRSHLRAAAYRMLGSVSEAEDAVQQAWLRLSRTETTG
51 VDNLGAWLTTVVARICLDMLRARKTRREEPLEMPMHAAIADPAKDPEQEA
101 VFADSVGLALLVVLQTLAPAERVAFVLHDMFDLPFDEIAPIIGRSSAATR
151 QLASRARRRVQGTDEAPEVDLGRKRTIAEAFLAASRNGDLEALIAVLAPD
201 VVFRPDATAARYGIGAMHGATAVAEAFKGRAQAAQIAVVEGELGFVVLIE
251 GQIRVAVSLTIDEGRIAAIDAVADPDQLERIEFSILRD

>ECFp11198 ECF41 ECF41s2 Kibdelosporangium aridum subsp. largum

1 MDAELFEQHRTRLRAVAYRMLGSAAEADDAVQDAWLRASRADTTEVENLG
51 AWLTTVVARVCLNMLRSREQRREDPFEIDVVASENPEQEAELVDSVGVAM
101 LVVLDTLAPAERVAFVLHDMFAVPFDEIAPMIEKSTAATRQLASRARKRV
151 KGAEHKPDLVRQREVADAYLAATRGGDFEALMTLLDPDVVLRADATALPM
201 GRSVVIKGAAPVAKRAMASASRAMFAGVALVNGAPGLVMAVGGKLAVVLA
251 FTYVDGVISEIDVIGHVDRLRTVDVAVMDI

Name Aliases LCA Taxa Group Subgroup
ECFp11277
Nonomuraea sp. SBT364 ECF41 ECF41s2

>ECFp11277 ECF41 ECF41s2 Nonomuraea sp. SBT364

1 MDEHAGDDRLAGRFEEHRSQLRAVAYRMLGSVSEADDAVQEAWLRLSRSD
51 VTGVDNLGAWLTTVVARLCLNMLRSRQTRREDPLETQPALEGGADPEREA
101 VLADSVGVALLVVLDRLSPAERLAFVLHDMFAVPFDEIAAMVERSPEAVR
151 QLASRARRRVRGASAPVSDAASRRRVVDAFLAATRGGDFEALVTLLHPDV
201 VLRADRLVVPTPEPVVVRGARVVAQGAMAATGRARFTGVALIDGAAALAM
251 APYGRLRLVLTFTVEAGLITGIDVIADPDRLRDLEFAVPDTILDVVPDVV
301 PDA

Name Aliases LCA Taxa Group Subgroup
ECFp11299
Labilithrix luteola ECF41 ECF41s2

>ECFp11299 ECF41 ECF41s2 Labilithrix luteola

1 MEERDLAARFEENRSHLRGVAYRMLGSLAEADDAVQESWFRLSRADTGEV
51 ENFRGWLTTVVGRICLDMLRSRKTRAEEDLESPATDARAATAGKGDPEQE
101 SLFADSVGLALLVVLETLEPAERLAFVLHDLFSVPFEEIATIVGRSPDAA
151 RQLASRARRRVRGAPTLPEAELESQRGVVAAFLAALRSADLDGLLAVLDP
201 ELVVRGDFGRGISEVRGAANWAKGAVLGAHGAPFVEVAIVDGSFGLVFAP
251 RGKKVVRALTFRFANGKVTSIEVIADRARLDQMEFAAPA

>ECFp11242 ECF41 ECF41s2 Rhizobium

1 MDEKKWLADEFEANRAHLRTAAFRMLGSRSEAEDAVQEAWLRLNRTDATG
51 IGNLGGWLTTVVARICLDMLRARKSRREEPLEMPMHAAVADPAGDPEREA
101 AFADSVGLALLVVLQTLAPAERVAFVLHDMFDLPFDEIAPIIGRSSAAAR
151 QLASRARRRVQGTDETPDVDLGRKRTIAAAFLTASRNGDLEALIAVLAPD
201 VVFRPDATAARYGIGATRGATDVAAAFKGRAQAAEMAIVDGELGFVVHID
251 GQIRVAVTLTIDEGRIVAIDAVADPDQLERLDFSILRD

>ECFp11392 ECF41 ECF41s2 Streptomyces virginiae

1 MDGNAWLTERFEEHRSHLRAVSYRMLGSLAEADDAVQETWLRLSRSDISE
51 VENLGGWLTTVVSRVCLNMLRSRASRREDSMDAYPTDPAGSREDTVDPEQ
101 EAVMADSVGLALLVVLDRLAPAERLAFVLHDLFAVPFDEIAPMIEKTPAA
151 TRQLASRARRRVKGAPLVPEADLTRRRHVVEAFLAATRGGNFDALVTLLH
201 PDVVLRADTAVVPTPAPILLRGAVTVATNAMAAMQRAQATAPALVDGTVG
251 LAMAPLGRLFLVLGFTIEDGLITEIDIMAEPERLGALELAALDV

Name Aliases LCA Taxa Group Subgroup
ECFp11300
  • RNA polymerase subunit sigma-70
  • VW23_023310
  • ... more
Devosia insulae DS-56 ECF41 ECF41s2

>ECFp11300 ECF41 ECF41s2 Devosia insulae DS-56

1 MDDEKILARRFEADRGHLKRVAYRMLGSATEAEDAVQEAWLRLSRSDTSA
51 VGNLSGWLTTVVARVCLDMLRTRKSRREEPLEQPATEAFDDKDDPEHALE
101 MADSLGVALLVVLETLPPPERVAFVLHDMFDLPFEEIAPIVGRSTDAARQ
151 LASRARRRVKGGSDNFEPSRERHREVVTAYLRASRSGDLAALLAVLDPEV
201 VLRADASAVPVGMALVARGAEVVARRALAGFMAEAQLALVGGEPAIVVLR
251 AGAPFRVLRFTVADERVTGIEVLADADRLAGLEVTALN

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more