ECF proteins of ECF subgroup ECF41s2

Displaying ECF 1 - 20 of 1206 in total

>ECFp173310 ECF41 ECF41s2 Rhodococcus jostii

1 MDDNEFLAHRFEQNRTHLKAVAYRMLGSLSEADDAVQEGWLRLSRAEVAE
51 VENLRGWLTTVVARVCLDMLRSRRTRREESLDIHVPDPIVREIDGADPEH
101 EAVLGDSVGLALLVVLDTLAPAERLAFVLHDMFALSFDEIAPIAGRTPGA
151 TRQLASRARRRVQGSEPVPDADLARQREVVEAFMAASRGGRFDALLELLD
201 PDIVLRADHGGPGSTLVRGARAVTEQALTFSRFAPFARLALVNGAAGVVA
251 APDGKAMSVMAFTVVGGKIARIDILADPHRLQRLGLSSVDD

>ECFp172943 ECF41 ECF41s2 Geodermatophilus siccatus

1 MSEDAVRAELLLAEQFEVHRAHLRAVAQRVLGSRDEADDAVQEAWLRLQR
51 AGSTGVDNLGGWLTTVVGRVCLDVLRRRAARREEPLELHASDPGGGPEPE
101 GEAVLADSVGLALLVVLDTLTPPERLAFVLHDLFAVPFDHVAAVLDRSPA
151 AARQLASRARRRVQGAAPGAAGPTDAGRRQQVVQAFLAAARDGDFAELLV
201 VLDPHVVLRADAAVPALGGLERLSGREAVARAFLGRARAARAALLDGAPG
251 AVFTPDGRLRGALEFVVPGDRITAVEVISDPAVLAALDVVLVET

Name Aliases LCA Taxa Group Subgroup
ECFp19596
  • DNA-directed RNA polymerase sigma-70 factor
  • PSHG_RS18355
Paenibacillus senegalensis JC66 ECF41 ECF41s2

>ECFp19596 ECF41 ECF41s2 Paenibacillus senegalensis JC66

1 MEEQFESQRNHLLAIAYRMLGSLTEAEDAVQETWLRLHRSDRSKIENLGG
51 WLTTVTSRICLDMLRSRKARREECMDEHLPENLAKDRYNPEQEALLADSV
101 GLALLVVLDKLKPAERMAFVLHDIFAVPFSEIAPIVGKSELATRKLASRA
151 RQKVRGNEIDSQTDLNQQRKLVDAFLAAAYAGNFDSLVAMLDPDVVLRDD
201 RETSVRSETRGAMSLAKKVSGHAKAAQAALVDGRIGAIAAPGGRLLYVIQ
251 FTIKDEKITEVDLISSSARLEQLNLTVLSD

>ECFp173440 ECF41 ECF41s2 Ktedonobacter sp. 13_2_20CM_53_11

1 MDEHEWLAKQFEAERPHLRAVAYRMLGDLTEAEDAVQESWLHLSRSDTSG
51 VENLGGWLTTVIARICLDMLRSRTSRREEPLEASVPEPITSREGGIDPEQ
101 EALLADSVGLALLVVLDTLNPAERLAFVLHDIFAMPFDEIAPIVERSPTA
151 ARQLASRARRRVRGAATVKGADLTYQREVVDAFLAASRGGNFDALLALLD
201 PDVVFRHDRTAVPAGASREVRGALAVARQFSGRAQGARPALVNGSVGLVV
251 ARHGRLFLVLNLTVAHGKIVEINVVADPERLRQLDLAVLDD

>ECFp19775 ECF41 ECF41s2 Streptomyces hygroscopicus subsp. hygroscopicus

1 MSAHDGLAEGFETHRSRLRAVAQRMLGSHSEAEDAVQEAWLRLARTEADA
51 VHNLGGWLTTTVSRICLDMLRARASRREDPAGHPVPDEDPGPAAGGRPEQ
101 EAVLADSVGRALLVVLDRLGPAERVAFVLHDMFTVTFDEIAPVVDRSLAA
151 AKQLASRARRKVRGAPAVPGAELARQRLVIEAFLAAARAGDIDAVLAVLA
201 PDVVRRADRAALPEGRPVEVRGARGVAKEIVVFGRNAHVAEVVLINGAVG
251 IVVAPYGRLRLALTVTTALRRITGYELIADPNRLQQLDLAVLDEAIALGG

Name Aliases LCA Taxa Group Subgroup
ECFp10655
  • RNA polymerase sigma 70
  • AC230_01070
Streptomyces caatingaensis ECF41 ECF41s2

>ECFp10655 ECF41 ECF41s2 Streptomyces caatingaensis

1 MTAPAEDGRDRLAERFERHRGRLRAVAHRMLGSSAEAEDAVQETWLRLHR
51 TGDDGIENLAAWLTTVLSRVCLDMLRSRAARHEEPARDVLFPDGPGGGDP
101 EDEVLLVDSVGRALLVVLDRLGPAERVAFVLHDLFAVPFEEIAPVVGRTA
151 ATTKKLASRARRKVHGEPVVPAADLARQRDVVDAFLAAARGGDIDGLLAV
201 LAPDVVRRADPAALPPGVPAEVRGADAVVRETAVLGRRARHAQPALLDGA
251 VGAVIAPRGRLLAALVPTIEHDRITAYEVIADPSRLRALDVAVLDPVGAG
301 APP

Name Aliases LCA Taxa Group Subgroup
ECFp11269
  • DNA-directed RNA polymerase sigma-70 factor
  • H505_RS0109590
Actinomadura rifamycini DSM 43936 ECF41 ECF41s2

>ECFp11269 ECF41 ECF41s2 Actinomadura rifamycini DSM 43936

1 MDERDFLAERFEEHRTHLKSVAYRMLGSLTEADDAVQEAWLRLARSETGQ
51 IGNLGGWLTTVVGRICLDMLRSRTHRGETPLEARLPDPIVSEPAADPEQQ
101 ALIADSVGLALLVVLESLTPPERLAFVLHDMFGLPFEEIAPIIDRTPAAA
151 RKLASRARRRVQGTAPEPEPDPAAQRRVVDAFLAAARGGDFDALVAVLDP
201 DVVLRADGGAALPGGMRVLRGREAVAGQAATFHRMATLTTSLPVLVNGTA
251 GLVNTLDGERFSVMSFTVTDDKITAIEILSDRDRLAALDLTGLEL

>ECFp19722 ECF41 ECF41s2 Kitasatospora sp. NRRL B-11411

1 MDEKEFLADRFETHRDHLRAVAYRMLGSSAEADDAVQEAWLRLERSDTSG
51 VENLAGWLTTVVGRVCLDLLRSRTSRREESFELRPGDGNAAVDGTAGPED
101 EALLADSVGLALLVVLDTLAPAERLAFVLHDLFAVPFDDIALVLERTPAS
151 ARQLASRARRRVQGRTPPEAPDPVRRREVVDAFLTAARGGDFDALLEVLD
201 PEVVVRADRAVPLLGPVEELRGRESVLGAFLGRAQGARTALVGGAVHAVW
251 APEGILRGALRFTIGGGRITAIEVVSDPAVLAGLEIVPLED

>ECFp14101 ECF41 ECF41s2 Rhizobium

1 MDEKKWLADEFEANRAHMGAAAYRMLGSRSEADDAVQEAWLRLNRTDTTG
51 VGNLGGWLTTVVARICLDMLRARKSRREEPLEAPLHAGIADPAKDPEREA
101 AFADSVGMALLVVLQTLAPAERVAFVLHDMFDLPFDEIAPIIGRSSAATR
151 QLASRARRRVQGLDEAPDVDLGRKRTIAEAFLTASRNGDLEGLIAVLAPD
201 VVFRPDATAARFGTIGEMRGAAQVAEAFKGRAQAAEIAIVDGEFGFVVQI
251 AGQLRVVVSLTIDDGRIAAIDAIADPDHLERLDYSILRD

>ECFp11332 ECF41 ECF41s2 Rhizobium mesoamericanum STM6155

1 MIEENWLAGEFEANREHLSAVAYRMLGSRAEADDAVQEAWLRLGRSDAGT
51 IDNIGGWLTTVVARICLDMLRSRKTRREEPFDLPIHERVADVSRTVDPER
101 EVAFADSVGVALLVILERLAPAERVAFVLHDMFDLPFDDIAPIIHRSSAA
151 TRQLASRARRRVQGKTDVPEADATRKKQIINAFLAASRLGDIKALLSILD
201 PQVVFTPDAAAMQYNPSVRELRGADAVAETFKGRAQAAQPAVIDGEFGFV
251 VAVNGQLRVVLLLTFNGEKIAGIDAVADAEFLGSLKYELF

Name Aliases LCA Taxa Group Subgroup
ECFp12054
  • DNA-directed RNA polymerase sigma-70 factor
  • B056_RS0130545
Frankia discariae ECF41 ECF41s2

>ECFp12054 ECF41 ECF41s2 Frankia discariae

1 MTGQDGLAARFDEHRAHLRSVAYRMLGSLHEADDAVQESWLRLSSSDTGD
51 VTNLRGWLTTVTGRICLDMLRARGSRREQPLDVHVPDPIVSPAKGGDPEQ
101 EALLAESVGLALHVVLETLTPAERLAFVLHDMFAVPFHDIAVLLGRSTAA
151 TRQLASRARGRIRAGGPLPEADLAQQHDVVRAFFDAARGGDFDALVALLA
201 PNVEMRSDGGTARPAATAALRGAAAVAGRALMFARPDAQVHPALVNGAAG
251 VVVTVAGRAVSIMGFTVRDQAIVAVDVLADVDRLGRLELSAFES

Name Aliases LCA Taxa Group Subgroup
ECFp18144
  • DNA-directed RNA polymerase sigma-70 factor
  • ON22_RS30945
Nocardia carnea ECF41 ECF41s2

>ECFp18144 ECF41 ECF41s2 Nocardia carnea

1 MHDDQFLADRFEEHRTHLRAVAYRMLGSLTEADDAVQETWLRLARTDTSD
51 VGNLGGWLTTVAGRVCLDLLRSRKTRHEEPFEAEHLPDPVIVSETTPDPE
101 SEAVLADSVGPALLVVLESLSPAERLAFVLHDMFAMPYEQIAPIVDRTPQ
151 TAKKLASQARRRVQGATPNPDLPRQRRVVGAFLTAARGGDFGELLRLLDP
201 DVVLRADAGATMRVIRGATAVAGQAETFRRMATTCTIHPAVVNGGAGLVN
251 TLDGNPFSVLGFTVTGDRITAIDILADPARLTHLDLTAILG

Name Aliases LCA Taxa Group Subgroup
ECFp12144
  • DNA-directed RNA polymerase sigma-70 factor
  • ON39_RS22660
Nocardia tenerifensis NBRC 101015 ECF41 ECF41s2

>ECFp12144 ECF41 ECF41s2 Nocardia tenerifensis NBRC 101015

1 MDEYLADRFEEHRAHLIAVAYRMLGSLAEAEDAVQEAWLRLARTDQDGID
51 NLGGWLTTAVSRVCLDLLRSRRARREDSFEEQLPDPVVRLDDGTDPEQQA
101 VLADSVGLALLVVLDSLNPAERLAFVLHDMFAMPFDQIAPILGKSSGAAK
151 MIASRARRRVQGETPRLDPDLPRQRRAVAAFLAAARDGSFDALLSILDPD
201 VMLRSDSGVGGVQIIRGATAVAGLLDTFHKFAIMYDITPAVVNGVAGLLN
251 TADGRPMSIIAFTVADDKITAIDLLADPARLAALPLPAR

Name Aliases LCA Taxa Group Subgroup
ECFp14695
  • hypothetical protein
  • A3CQ_RS0119605
Actinoplanes globisporus DSM 43857 ECF41 ECF41s2

>ECFp14695 ECF41 ECF41s2 Actinoplanes globisporus DSM 43857

1 MDDTALAERFEENRPRLRAVAMRMLGSVAEADDAVQEAWLRLSRTGDAEV
51 DNLAAWLTTVIGRICLDMLRQRTARREDDYDTEPPTAEVTPEDEAMLADS
101 VGLALLVVLDTLTPAERLAFVLHDLFAVSFEEIAPVVGRSPDATRQLASR
151 ARRRVRATPSAGSPADRRLVDAFIDASRGGDLGTLLTLLDPDVEMRIGPV
201 SQRRGADVVARFFSGRAQAARPALLDGALGIAIVVGDGLKAALRVTTDGS
251 RITVLEAITDPTQLAALDVELLKD

>ECFp10477 ECF41 ECF41s2 Bradyrhizobium jicamae

1 MDEKKFLAEKFEANRGHLRAVAYRMLGSTAEVDDAVQETWLRLNRSDTSA
51 VENLSGWLTTVVARVCLDMLRSRKSRREEPMGPHVPEPVADDAYGRDAEM
101 ADSVGAALLVVLGTLAPAERLAFVLHDMFAVPFEEIAPIVGRTPAAARQL
151 ASRARRRVQGSPPPDADFDRQKNIVDAFLKASRDGDFEGLLAVLDPDVVV
201 RADQAAQRLGSQAEIRGATAVAEFFKGRAQAAKPALVDGSLALAVMLGGQ
251 LRVVVRLTISGDRISAIEAVADAEQMGEFDVALLS

Name Aliases LCA Taxa Group Subgroup
ECFp19968
  • RNA polymerase sigma 70
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Streptomyces ECF41 ECF41s2

>ECFp19968 ECF41 ECF41s2 Streptomyces

1 MSDGDQHRHGDQHREDFLAERFEEYRGHLRAVAHRMLGSVAEAEDAVQEA
51 WFRLSRSDTREVQNLAGWLTTVVGRVCLDMLRSRRSRGEQPLDTWSPAPS
101 AEPDPAQDALRADSVGSALLVVLETLSPAERLAFVLHDLFGVPFEEIGGI
151 LGRSPAAARQLASRARRRVRGADAPEADLVRQREVVDAFLAAARDGDFDG
201 LLAVLDPEVVARGEAGVTIGATDVAATAASFGHLAGVALPALVDGATALV
251 VLTDGRPERVLTFTFAADRIAGIDVVTDPARLAELSIEPA

Name Aliases LCA Taxa Group Subgroup
ECFp16293
Frankia sp. CgIM4 ECF41 ECF41s2

>ECFp16293 ECF41 ECF41s2 Frankia sp. CgIM4

1 MEDATWQAEQFERQRPRLQAVAYRMLGSLSEAEDAVQEAWLRLSRSGDEA
51 INNLGGWLTTVVGRVCIDMLRARQARREDFVGTWLPEPIVSAEDGDGPEQ
101 QTVLADSVGLALLVVLETLTPSERLAFVLHDMFAVPFEEIAPIVDRTPAA
151 ARQLASRARRRVRGAPTVPDPDLAAQRKVVAAFLAAARAGDFDALVAVLD
201 PDVVFRVDTGSRTRLMPTLLTGSADVAQHTAIQGPRFARHCQPALVNGTA
251 GIVARASTGVIAVAGLTVRDGRIATIDLILDPDKLHRLVLAD

>ECFp14364 ECF41 ECF41s2 Candidatus Frankia californiensis

1 MDDETWQAEQFERQRPQLHAVAYRMLGSLSEAEDAVQETWLRLSRSNDDA
51 IGNLGGWLTTVVGRVCIDMLRARQARREDYVGTWLPEPIVSVEDSDGPEQ
101 QTLLADSVGLALLVVLETLTPSERLAFVLHDMFAVPFEEIASMLERTPAA
151 ARQLASRARRRVQGSATVPDTDLATQRKVVAAFLAASRAGDFDALVAVLD
201 PDVVFRVDTGSHPRPVPALLTGAVDVARQVAVQGPRFAQHCRPALVNGTA
251 GIVARTSAGLIAVAGLTVIEDRIATIDLILDPDKLHNLVLVD

>ECFp16054 ECF41 ECF41s2 Streptomyces

1 MNEDEWLAERFERERPRLRAVAYRMLGSVAEADDAVQDAWLRLSQSKAEH
51 IDNLSGWLTTVVTRECLHQLRSRRRRREDPLVEHLPDPIVRAEDPDPEQE
101 ALLADAVSLALLVVLERLTPAERLAFVLHDMFDLPFDEIAQIVDRTPAAA
151 RKLASRARRRVDGAEIPRPDPDLARQRKVVAAFYAAARAADLDALVQVLD
201 PDVVERTEFGAARSPQVVRGAAAVARRVRAPRGGELRPVLVNGAVGALVT
251 RNGQAYSVMAFTVTGDKIVRIDVIRNADRVRSLTSGVLGQPG

Name Aliases LCA Taxa Group Subgroup
ECFp14506
  • hypothetical protein
  • AMYNI_RS0138305
Amycolatopsis nigrescens CSC17Ta-90 ECF41 ECF41s2

>ECFp14506 ECF41 ECF41s2 Amycolatopsis nigrescens CSC17Ta-90

1 MDENDWLAERFERHRPRLRAVAYRMLGSLTEADDAVQDAWLRLSRSDPEQ
51 IDNLGGWLTTVVARECLHLLRSRRRRREEPFATHPPDPVVVPDGDLDPEQ
101 EALLADSVGLALLIVLDRLAPAERLAFVLHDMFELPFAEIAGIVGRTPIA
151 ARQLASRARRRVNGADLPSPDPDVARQRKVVNAFYAAARTGDIDALVGVL
201 DPDVVLRTDFGTARPAVVVHGARAVAEQARAPRGGALRSALVNGTVGAVI
251 TRDGRPFSVMAFTVAGQRIVRIDVVQDPDRVRRLASSVLGQ

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more