ECF proteins of ECF subgroup ECF41s10

Displaying ECF 161 - 180 of 392 in total

>ECFp138618 ECF41 ECF41s10 Micromonospora matsumotoense

1 MARALTLCAGPASGDVGPARRTAYGRRMTTGPGTAADGPPAVAAADLAAF
51 LDVRPRLFGLAYRMLGSVVEAEDVVQEAWLRWQGTERSGVRNPAAFLTTT
101 TTRLAVNAATSARATRETYVGPWLPEPVDTSADPTLGAERAAALDVAVLL
151 LLERLAPAERAAYVLREAFDYPYREIAEVLGTSEPNARQLASRARRHLAV
201 EGSPPAPPQRRRQLVRAFLGAARDGDLATLERLLTDDVVARADGGGRVHA
251 SRRDVCGAARVTNFLDNVRRKYWRGTTIDLVEVNGGPGLLVATDRPITLI
301 TLDTTVRGIERLLLVVNPDKLGRLPARR

>ECFp138670 ECF41 ECF41s10 Streptomyces sp. yr375

1 MDAQQPLTDDSLDEAADAFQRLRPRLFGIAYRILGSVSEAEDVVQDVWVR
51 WQGTDRSGVLDTGAFLAKITTRLAINVAQSARVRREAYVGPWLPEPVDTS
101 VDPQVGAERGEALELAVLLVLEKLNPVERAAYVLREAFDYPYDDIAGMLR
151 LSQANTRQIVSRARKRLSAERRDPVDTAEHRRLLDAFVAAAQHGDVAALE
201 HVLSADVVAYADGNGIRGVARLEVAGARRVARISAFAKKFFPDADYGVAE
251 ANGLPSLLLTKGSVAVALVSVTVGPDGIDGLYWVLAPDKLSAYEQSARRL
301 TVRPRQTG

>ECFp138691 ECF41 ECF41s10 Micromonospora haikouensis

1 MTVDETHNAATTAVPSPAGPGDGLAEFVAVRPRLFGIAYRMLGSVAEAED
51 VVQDAWLRWQSAERGAVRNPAAFLTTTTTRLAINAATSARAVRERYVGPW
101 LPEPVDTSADPALGAERAEALDLAVLLLLERLTPTERAAYVLREAFDYSH
151 RQVGEVLDTSEVNARQLVSRARRHLASQRSSPVSAARRRELVEAFLDAAR
201 EGDVAALERLLAEDVRAWSDGGGRVNAVRKELAGVGRVTTFLDNVLRKYW
251 HTAGFRFVEVNGGGSLLVTNADGSPQSLVALDCSDRGIERVLIVVNPDKL
301 RRFAGAG

Name Aliases LCA Taxa Group Subgroup
ECFp138696
Actinomadura madurae ECF41 ECF41s10

>ECFp138696 ECF41 ECF41s10 Actinomadura madurae

1 MSGYQRDGGIIVGGIGPAERDDLGEAAAVFAGVRPRLFGIAYRMLGSATE
51 AEDLVQDVWLRWQTTDRGTVAEPAAFLATATTRLAINVLRSARVRRETYV
101 GPWLPEPVDTGADPHLGAERGEALSLAILFLLEKLSPTERAAYVLREAFD
151 YPYPQIAEIVQVSDVAVRQLVSRARKHLRSERRAPVTGAERRRLLTAFVA
201 AARTGDLTALEAILAADVISYSDGGGAVRASRFPVVGAFRVAKYVRAFAD
251 RFWDGVDVQWAHVNGQEAALLHREGELFTVLAVDASGPRIDRVLWMMNPA
301 KITAASAG

>ECFp138730 ECF41 ECF41s10 Amycolatopsis saalfeldensis

1 MQETADLDGAAVVFAGVRGRLFGIAYRMTGSVADAEDLVQETWLRWQNCD
51 RSAVADPGAYLATAITRLAINAGQTARARRETYVGPWLPEPVDTSADPQL
101 GAERSAALEFAVLLLLEKLSPTERAAYVLREAFDYPYPQIAEIVRTTEAA
151 ARQLVSRGRKRLAAERRAPVSAPEQRRLLSAFVAAARVGDLSALEELFAA
201 DVVSYSDGGGVVRASRIPVHGAKTVAKYLRAFASRFWAGVDVAWVEANGG
251 PGALLRRDGEAIAMVTLTSSADGIEQLLWVLNPGKLAAITEP

Name Aliases LCA Taxa Group Subgroup
ECFp13914
Jiangella alba ECF41 ECF41s10

>ECFp13914 ECF41 ECF41s10 Jiangella alba

1 MVPVTTDGVAEFLDVRPQLFGIAYRMLGSVAEAEDIVQDAWIRWQRTNRD
51 EVQNPAAFLTTTATRLALTAATSARARRETYPGEWLPEPVDTSDDPALGA
101 ERAEALDLAVLLLLERLSPAERAVYVLHEAFDYPYRRIGEILEVSEPHAR
151 QLARRARLALESGRAEPAPPDMRRRLVETFVAAARDGDLEGLERLFTEDV
201 TARSDGGGKVRASRVDLEGVERVLLFIDNILRKYWSEATFTVVDANGGSA
251 LLVTNPAGAAQAVLALDVTTRGVERVLFVVNPDKLRGFGRQ

>ECFp13931 ECF41 ECF41s10 Streptomyces sp. PsTaAH-124

1 MQADDDGSAPDSPGSAPDSSGSSLDRAARDFVAARRQLFGIAYRVLGSAA
51 EAEDVVQEAWVRWQNTDRSGVREPLAFLTTVTTRLAVDVARSARVRRESY
101 VGPWLPEPVDTRSDPQLGAERAEAVELAVLLLLEKLNPVERAAYVLREAF
151 DYPYRRIADILETSEPHTRQLVSRARGRLTDGRREPAGPAAHRRLLEVFL
201 GAARTGDLAVLEDVLAADVVSYSDGGGMRGASRIPVVGRTRVARYLAAFA
251 PRFWPAARVRWTEANARPAVLVSFDGEPAALLSVDVSERGIERIMWVMNP
301 AKLLPYAASLGGGED

>ECFp13988 ECF41 ECF41s10 Nocardia kruczakiae NBRC 101016

1 MCASSTLTVMPEPDSARGPLTPEATGYAADFQGLRPRLFGIAYRMLRRAP
51 DAEDVVQDVWLRWQGTDRTVVRDRVAFLVTITTRLSLNAAGSARARREIS
101 VDHWLPGQVLAAEDPAQATERSAELEQAVLLLLQRLSPTERAVFVLREAF
151 DYPFRDIAERLQISEANARQLGRRARAHMAGPRREPVHRAARDRLLSAFR
201 TAAQDGAVVHLERLLTDDILAARP

>ECFp14036 ECF41 ECF41s10 Mycolicibacterium tusciae JS617

1 MSIEALKSRETLEEAAVTFLACRDRLFGIAFRILNDCAAAEDIVQDAWLR
51 WQTCDRSVVLDPLAFLTTTTKRLCINVVQSARARHETHMDSWLPEPVDRN
101 ADPERRIEQCEALELAALTLLERLSPPERAAYVLREAFDYSYAEIATIVE
151 VTQANARQLVSRARKRLAAERREAPTGAEQKRLVVALTAAAQSGDLSTLE
201 TVFTEDLAVAA

>ECFp14045 ECF41 ECF41s10 Microbacterium

1 MAESGFGETADLDEAVRVFDTHRRRLFGIAYRMLSTVADAEDIVQETWIR
51 WQNTDRSKIQEPVAFLTTITTRLSINVLQSSHSRRETYIGPWLPEPVNTD
101 DDPALGAERAEALQFAILLTLEKLTPTERAAYILREAFDYPYPRIAEVIS
151 SSVVSARQLVSRARAHLSSARNAHVDPVAQRRLLEAFLTAAQKGDAHELE
201 ALFAADVVSYTDGNGVKLAARIPVMGRGRVAKFVAAFAHHFWIGKTIDWV
251 QVNGQPAATLVENGTVTTMVTVTTSSEGILQLLWVMSPQKLGHVNAVTA

>ECFp14057 ECF41 ECF41s10 Nocardia fusca NBRC 14340

1 MHSTSITNVISEPDQTRPSSSEVAGYVADFQGARPRLFGIAYRMLGRAAD
51 AEDIVQDVWLRWQGADRTQVRDRIAFLVTITTRVTLNATSSARARHEVLV
101 DRWPPEELPTSDDPSLTTERAADIEHAVLLLLQRLTPTERAVFVLREAFA
151 YPFRDVADRFGISETNARQLCHRARARLAGPRHEHEPVSRADQDRLLRAF
201 LDAAQHGAMAHLERLLTADVRSDSARRRRRQQMNPSCGQKGQAGEAFPRP
251 SQSPSAALSKLS

>ECFp14058 ECF41 ECF41s10 Microbacterium sp. Root280D1

1 MRDLGTAVSVFAAQRRRLFGIAYRMLGTVADAEDIVQETWIRWQNTDRTQ
51 VQEPAAFLTTITTRLSINVLQSARVKRETYIGPWLPEPVNTDDDPSLGAE
101 RAEALQFAILLTLEKLTPTERAAYILREAFDYPYPRIAEIISSSAVSARQ
151 LVSRARAHLASAKQITVEPSHQRHLLEAFLAAARKGDARELEKLFAADVV
201 SYTDGNGVKLAARIPVIGRGRVAQFVAAFAHHFWTGKSIGWVEVNGQPAA
251 TLVENGEVTTMVTVTASDEGIEHLLWVMSPQKLGHITAVAT

>ECFp14063 ECF41 ECF41s10 Streptomyces

1 MQTEAEADSLDRATRQFLAARPQLFGIAYRMLGSSAEAEDILQDAWVRWQ
51 NTDRTGVREPAAFLTTVTTRLAINRATSAQARRETYIGPWLPEPLDTRAD
101 PQVGAERAEAVELAVLFLLEKLNPLERAAYVLREAFDYPHRQVAEILQTS
151 EANARQLVSRARRHLAAERRERVSPAEHRRLLEVFVAAARTGDLAALERV
201 LTADVVHYSDGGGIRNAARIPIVGRTHVSKVMVAFAPRFWPDAEVRWVEA
251 NGRPAVLVSSEGTAKALLSIDARADGIDRLLWILNPEKLAPYVASLDG

Name Aliases LCA Taxa Group Subgroup
ECFp14070
Sorangium cellulosum ECF41 ECF41s10

>ECFp14070 ECF41 ECF41s10 Sorangium cellulosum

1 MTAPRVPGGPQPAADPFFALRPRLLGIAYRILGSRAEADDVVQDTWVRWQ
51 ATDRATVQEPTGFLVTATTRLAINVAQSARVRREAYVGPWLPEPIDTSPS
101 AELGAETQEGLALAVLVLLEKLSPTERAVYVLREVFDYPYEEIAGILDLG
151 EANVRQLLVRARKHLAGERRAAVGVEQQRRLLEGFIAAAQKGDLSALERL
201 FAADVASITDSNGRVRMAARVPVHGRERVAKLVAGFASRFWPGTTVTWLE
251 TNGQPSVLIRRDGVAVAFAAIDASAEGIEQIYWMMNPEKLATF

>ECFp14111 ECF41 ECF41s10 Rhodococcus

1 MTDDGTAAFELARPRLFGIAYRMLGSAAEAEDVVQDVWLKWHATDRTTVR
51 NSLAFLTTVTTRLAINVTQSARVRRESYVGPWLPEPIDTRADPATVADND
101 ATVELAVLVVLERLPARERAAYVLREAFDYPYGRIADIVETTEANARQLV
151 TRARRHVADARPTPVDSDRHHRLLDAFLAAAKGGDLAALEKILAQDVVSL
201 SDGGGKVKAAARIPIVGRSRVAAFVAAFSSHFWIGTTTSFIQVNGRAAVL
251 IVRESTVTTLLTIDATEDGIGTVLWVMNPDKLHALPR

Name Aliases LCA Taxa Group Subgroup
ECFp14139
  • RNA polymerase subunit sigma-24
  • AOZ06_21565
  • ... more
Kibdelosporangium phytohabitans ECF41 ECF41s10

>ECFp14139 ECF41 ECF41s10 Kibdelosporangium phytohabitans

1 MVAGVEPVAVDHAVEVFTEARPRLFGIAYRMLGSAIDADDLLQEVWLRWQ
51 TYDHSKVDNPTAFLATVTTRLAINATQTARVRHETYVGQWLPEPVDTSAD
101 PQLGAEREAALEFAVLMLLEKLPATERAAYVLRAAFDYPYAQIAEIVQVS
151 EAAARQLVSRARKHLAAERRTPATVQDQRRLLTAFVAAAKSGDLATLEEL
201 LAADVVSYSDGGGVARASKIPVVGRDRVSRYVRAFADRFWAGIDIAWVRV
251 NGQEGALLTVNGERYGLVTVTASDEGIDQVMWLLNPHKLAAV

>ECFp14184 ECF41 ECF41s10 Herbidospora sakaeratensis

1 MIRVDSLENAASVFTELRPRLFGIAYRMLGSAAEAEDVVQDVWLRWQGAD
51 RAAVQSPPAFLATIATRLSINVARSARARRESYIGPWLPEPVDTSADPTL
101 GAERGEALEFAFLLLLERLTPTERAAYVLREAFVYPYEQIAEIIQVSAAN
151 ARQLVSRARKHLAAGRHEPIDKTEHRRLLETFLDAAQSGDVVALEHLFAE
201 DVVSLTDGNGVRGAARLVMHGVPRVTKFIAAFAPRFWPGATVTFVDVNGN
251 PGVFVPAREKVGGALLVLDASRDGIHQLLWVMNPDKLAGYSK

Name Aliases LCA Taxa Group Subgroup
ECFp14281
  • RNA polymerase sigma24 factor
  • G002_RS0102115
Acidobacteriaceae bacterium KBS 83 ECF41 ECF41s10

>ECFp14281 ECF41 ECF41s10 Acidobacteriaceae bacterium KBS 83

1 MAEEPISETPSSSHLNAETGEHDDGLSAFASVRPRLFGIAYRMLGSAAEA
51 EDIVQDVWLRWQATNRSEVENPPAFLATTATRMCINFSQSAQSRRETYIG
101 PWLPEPVDTSSDPALGAERGEALGFAILLLLEKLSPTERAAYVLREAFDY
151 SYRQIADILQMEEANTRQLVSRARKHIADGRRTPASSQEQRRLLEAFIGA
201 AQKGDLAALEGLFAEDVVSYSDGGGVVRTAARAPVSGRERVAKFISAFAS
251 HFWTGLTLAWVEANGQASVLMSRDGIPVAFATIDASAEGIDKIMWIMRPS
301 KLTVVATSRLKIG

>ECFp14425 ECF41 ECF41s10 Streptomyces sp. SPB074

1 MVNRSLEASGSRTVTAGSELHRPRSALLLVRAPVCHAGESGAGWDDSQRD
51 RDYGTRGPRGGTLCAVIADSVREFESERPRLFGLAYRMLGSAQEAEDVVQ
101 DAYLRWAGTDRATVRTPGAWLTTTVTRLCLTVLDSARVRRERYVEPWLPE
151 PVLTSGGALGPMESAEQREEVSSALLLLLERLSPPERAVYVLHHAFGYGH
201 REIAGILGLSEPGARQHLRRARARLAEERARYAVAGERQRALVETFLAAS
251 RAGDVSELVSLLAEDVSWWSDGGGRVPAARKIVVGREPVAGLIRMALEKW
301 LVGAEFRPAEINGAPALLFFA

>ECFp14432 ECF41 ECF41s10 Actinoplanes subtropicus

1 MAGDLDEAAEVFTEARPRLFGIAYRMLGSATEAEDLVQDVWLRWQGYDRD
51 SVRNPGAFLATTTTRLAINELQSARARRETYIGPWLPEPVDTSADPYLGA
101 ERGEALEFAVLLLMEKLTPNERAAYILREAFDYPYGQIADILQSTEPAVR
151 QLVSRARKHVAGERKVPVSEEMQRELLATFLEAARSGDLAALERLFAADV
201 ASIADGNGARQISRKIVAGATRVATFVAAFSSWYWAGVEVRHVTMNGRPG
251 AVMSKDGRLLGAVTLTASADGIEQLLWMMNPEKLSSL

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more