ECF proteins of ECF subgroup ECF41s10

Displaying ECF 141 - 160 of 392 in total
Name Aliases LCA Taxa Group Subgroup
ECFp13420
  • RNA polymerase subunit sigma-24
  • ASC59_08115
  • ... more
Leifsonia ECF41 ECF41s10

>ECFp13420 ECF41 ECF41s10 Leifsonia

1 MDATLDDALAAFQAVRGRLFGIAYRMLGSASEAEDIVQDAWLRWQGADRA
51 QVQDPSAFLATVTTRLAINALQSARAQRETYIGPWLPEPVDTSEDPTLGA
101 ERAEALGVAVLVMLERLTPTERAAYVLREAFAYPYEQICDIVQVSEPAAR
151 QLVSRARKHLTGERRREVPQSEQRRLLTAFLAAAKTGDLVGLEHLLAEDV
201 VSFSDGGGVVRASKFPVVGRQRVAKFITAFHSHFWAGVDSIEANTNGQAS
251 VLLSKEGSIFAVLTVVVGAEGIDQVLWMMNPHKLEAVTISAAV

Name Aliases LCA Taxa Group Subgroup
ECFp13418
  • hypothetical protein
  • WYM_RS06310
Microbacterium yannicii PS01 ECF41 ECF41s10

>ECFp13418 ECF41 ECF41s10 Microbacterium yannicii PS01

1 MGSSTAPAADAEDMDSAVDVFEQHRRRIFGIAYRMLGTVADAEDIVQETW
51 IRWQNTDRDSILEPAAFLATIATRLSINATQSARARRETYIGPWLPEPVN
101 TDADPALGAERGEALQFAILLTLEKLTPTERAAYILREALDYPYERIADI
151 VGATVESARQLVSRARKHLASAKRAQVAASDHRRLLEAFLVAAQKGDVSA
201 LEKLFADDVVSYTDGNGVKLAARIPVAGRHRVAQFIASWSSHFWVGKTID
251 WVELNGRPAATISDADGVMTTCALTMSDDGIMQVFWTMSPDKLRHAAPAG
301 A

>ECFp13463 ECF41 ECF41s10 Saccharothrix sp. NRRL B-16348

1 MGVRPRLFGIAYRMLSSATEAEDLVQEVWLRWQTCDRSVVVNPAAFLATT
51 ATRLAINALQSARVRRETYVGPWLPEPVDTSADPYLGAERGEALEFAALM
101 LMEKLSPNERAAYVLREAFDYSYAQIAEILQSTEPAVRQLVSRARKHMAG
151 ERRTPATAAAQRELLTTFITAARTGDLMALERLFTADVTSLSDGNGRLRV
201 ARKRIVGPPAVTQFLDAISTWFWDDLDVRWASANGQVSAVLRRNGAEFGV
251 LAVTATTDGIDRVLWMLNPEKIGALSDASGSPTSHAAVVPGRGRRLRKT

>ECFp13531 ECF41 ECF41s10 Actinoplanes awajinensis subsp. mycoplanecinus

1 MTESTARTADDLEEAARIFTGVRPRLFGIAYRMLSSAGEAEDLVQDVWLR
51 WQGYDRSTVTNPAAFLATTTTRMAINVLQSARVRRETYIGPWLPEPVDTS
101 ADPYLGAERGEALEFAALLLMERLTPSERAAYVLREAFDYPYGQIAEILQ
151 STEPAVRQLVSRARKHVAGERRTPVAPQAQKDLLARFIVAARTGDMTALE
201 RLFAADVASVSDGNGAVRVARRPVVGAERVAKFFTALSGWYWVDVEVSWV
251 TANGGPAAVLRRNGVLEGVITMVVSADGIERILWIVTPEKIAAFA

>ECFp13589 ECF41 ECF41s10 Streptomyces odonnellii

1 MGARDDADSLDRATRDFMAARPRLFGIAYRVLGSAVEAEDIVQEAWLRWQ
51 NADRDVIREPAAFLATVTTRLAINFTQSARVRRESYIGPWLPEPVDTSVD
101 PQLGADRAEALDLAVLFLLEKLNPVERAAYVLREAFDYPYRRIADIVETS
151 EANARQLVSRARKHLSAERREPVSPVAHRRLLEVFLAAAQTGDLPVLEEI
201 LTADVVSYSDGGGVRGASRIPVVGRTRVSKFLAAFAPRFWPQSETRWVEA
251 NGRPAVLVSSGGHAVALLSLDVSARGIERVIWMMNPAKLDPYVASLGV

Name Aliases LCA Taxa Group Subgroup
ECFp13666
Sorangium cellulosum ECF41 ECF41s10

>ECFp13666 ECF41 ECF41s10 Sorangium cellulosum

1 MTAPRVREDSPPAADPFVALRPRLLGIAYRILGSRAEADDVVQDTWVRWQ
51 AIDRATVQEPTGFLVTAATRLAINVAQSARVRREAYVGPWLPEPIDTSPS
101 AELGAETREGLALAVLVLLEKLTPTERAVYVLREVFDYPYEEIAGILDLG
151 EANVRQVFARARKHLAGERRAPVGVEQQRRLLESLIAAAQKGDLAALERL
201 FAADVASTTDSNGRVRMAARVPVHGRERVAKLIAGFAGRFWPGTAVTWLE
251 TNGQPSALIRRDGVALALASIDASAEGIERIYWMMSPEKLSTFVASR

Name Aliases LCA Taxa Group Subgroup
ECFp13761
  • RNA polymerase sigma factor
  • RNA polymerase sigma24 factor
  • ... more
Streptomyces bingchenggensis BCW-1 ECF41 ECF41s10

>ECFp13761 ECF41 ECF41s10 Streptomyces bingchenggensis BCW-1

1 MTFTDHSPLGTTTSALDEAVSVFVQLQPRLFGIAYRVLGSAVEAEDVVQE
51 VWLRWQKTDRSAVVSPAAFLSSATTRLAINVAQSARVRRETYIGPWLPEP
101 IDTSSDPEVGAQRAEALELALLLVLEKLSPAERAAYVLREAFDYSYPEIA
151 DMLQLSVVNVRKIVSRARKHLGAEQRESVDAEEHRRLLEAFVGAAQRGDI
201 GSLEALLTPDAVSLSDGNGMRGAARIPVLGRARVANLATAYPRFWRGLDL
251 RSVHANGRSGVMIYREGEPKTFLTVAASREGIYKVMWLFNPSKIAAFLDS
301 RSRSM

>ECFp138173 ECF41 ECF41s10 Mycobacterium tuberculosis

1 MNAIVEERDRAGSLDRAAAVFLGVRPRLFGIAYRMLGSPAEAEDIVQETW
51 LRWQNADRSAVANPAAFLALITTRLSINTAQSARARRETCAGPALPEPAD
101 AGPGPAAEAVRGDAVERALLLLLERLTPAQRAAYVLREAFGYPYPEIAAI
151 IRLSPANVRQLVSRARRHLDTGRRAPAAGTGQRRLLTAFLGAAQDGNVAA
201 LEALLAADVAGATGDAGLSRAA

>ECFp137831 ECF41 ECF41s10 Micromonospora rhizosphaerae

1 MVNSGVNHEPVGTDDLEEAAAVFTSLRPRLFGIAYRMLGSATEAEDLVQE
51 VWLRWQTCDRGAVIDPAAFLATTTTRLAINALQSARVRRETYIGPWLPEP
101 VDTSADPYLGAERGEALEFAALLLMEKLTPNERAAYVLREAFDYPYAQIA
151 DILQSTEPAVRQLVSRARKHMTGERRTPASAAAQRHLLTTFITAARSGDM
201 TALERLLAANVTNIGDGNGRVRVSRRPVVGVVRVAKFLTAISTWFWDGVE
251 VRWASTNGQTSAVLWRDGTLDAIVTVSASTDGINQVLWVMNPEKTAAVSG
301 LA

>ECFp137995 ECF41 ECF41s10 Streptomyces

1 MVIAEPEGATMDARDASESLDRATEDFLAARPRLFGIAYRVLGSAAEAED
51 VLQETWVRWQNTDRSGVKEPAAFLTTITARLAVNVAQSARVRRESYVGPW
101 LPEPVDTRHDPQLGAERAEALEMAVLLLLEKLNPVERAAYVLREAFDYPY
151 KQVAEILETSEPNTRQLVSRARKHLSAERKEPVSRADHRRLLEVFLAAAQ
201 TGDMRVLENVLAADVVSYADGGGIRGASRIPVVGRLRVSKYLAAFAPRFW
251 PPAETRWVEANGGPAVLVTAGGNPVALLSVDASEDGIHRVMWVMNPEKLS
301 PYVTSLTA

>ECFp138151 ECF41 ECF41s10 Amycolatopsis sacchari

1 MGVSEGDVAAFVAARGRLFGIAYRILGSAGEAEDVVQDTWLRWQRADRGA
51 VEDPTAFLATTATRLAINVAQSARVRRERYVGPWLPEPVETAADPALGAE
101 RAEAVDLALLVLLERLSPTERAAYVLREAFDYPYRQIAEVLGVGEANARQ
151 LVSRSRKHVREGRRARVEPGEHRRLVEAFVSAATTGDLAELERLLAVDVV
201 AWADGGGTVHAAKRPVLGRDRVARFVAWVAAKRWLDAERRFVEANGRTAL
251 LVLRDGEPKFLVSLETTVDGIAQVLLVLNPDKLHHVTHVASQERALSGPR
301 WDRTTGVRREEGFQR

>ECFp13828 ECF41 ECF41s10 Streptomyces sp. NRRL S-1314

1 MDARDAADSLDRATDDFLAARPQLFGIAYRVLGSTAEAEDVLQETWVRWQ
51 NTDRSGVKEPAAFLTTITARLAINVAQSARVRRESYVGPWLPEPVDTRHD
101 PQLGAERAEALEMAVLLLLEKLNPVERAAYVLREAFDYPYKQVAEILETS
151 EANTRQLVSRARKHLAAERKEPVSPADHRRLLEVFLAAAQTGDMRVLENV
201 LAADVVSYADGGGIRGASRIPVVGRLRVSKYLAAFAPRFWPPAETRWVEA
251 NGTPAVLVTAGGKPVALLSVDASADGIERLMWVMNPEKLSPYVTSLTA

>ECFp138368 ECF41 ECF41s10 Leifsonia

1 MTGPVEQDDLDTAAATFAAVRPRLFGIAYRMLGTVADAEDIVQDTWERWQ
51 RTDRSAVREPAAFLATAATRLAINQAQSARVKRETYIGPWLPEPVDTSAD
101 PALGAERGEALEFAVLVLLEKLTPTERAAYVLREAFDYPYPQIAEIIQGS
151 EASARQLVSRARKHLAEERHVREVDHAQQKRMLEAFLEAAQSGDIAELER
201 IFTADIVSYSDGGGLARASRIPVFTRETVAKYVHAFADRFWDGTVRLIEA
251 NGGPAAVLVRDGAVVAFIALDVTADGIRRLQWVLNPQKLERIPVPA

>ECFp138380 ECF41 ECF41s10 Mycobacterium sp. UM_WWY

1 MTDLADAEEVFTEVRPRLFGLAYRMLGSVAEAEDVLQDAWVRWQATDRDD
51 VREPAAFLITMVTRMCVNVLQSARVRRETYIGPWLPDPVDTSADPALGAE
101 RGEALQVATLMLMEKLAPPERAAYILREAFDYPYELIGETIAVTDVNARQ
151 LVSRARRHLAARRGEPASTEAQRRLLTAFVAAAQTGDMSDLEELLASDVA
201 SYTDGNGMRNAAPVPVVGRERVAKFVLAFRRRFWRNSTVTWITANGQGGA
251 LISQDGRLAAFLTVAVSAEGIEELLWVLSPDKLAHIATAVPDPAETV

>ECFp138415 ECF41 ECF41s10 Streptomyces sp. DvalAA-14

1 MVNRMSKGETMPAGDDAASLDRAAREFIAARGRLFGIAYRVLGSAAEAED
51 IVQEAWLRWQNTDRARIAEPAAFLTTVTTRLAINSAQSARVRRESYIGPW
101 LPEPVDTGPDPQLGAERAEALELAVLFLLEKLNPVERSAYVLREAFDYPY
151 QRIAEILQTSEANSRQLVSRARRHLAAEHREPVGAAARRRLMEVFLDAAR
201 RGDLAALEKVLAEDVVSYSDGGGTRGASRIPVAGRARVSRYLAAFAPRFW
251 AGSDLRWVEANGGPAVLVSAQGNAVALLSAEVSEQGIDRILWIMAPDKLS
301 SYMESVGS

>ECFp138473 ECF41 ECF41s10 Streptomyces gancidicus BKS 13-15

1 MVSAEPEGATMDARDAADSLDRATDDFLAARPQLFGIAYRVLGSAAEAED
51 VLQETWVRWQNTDRSGVKQPAAFLTTITARLAINVAQSARVRRESYVGPW
101 LPEPVDTRHDPQLGAERAEALEMAVLLLLEKLNPVERAAYVLREAFDYPY
151 KQVAEILETSEANTRQLVSRARKHLAAERKEPVSPADHRRLLEVFLAAAQ
201 TGDMRVLENVLAADVVSYADGGGIRGASRIPVVGRLRVSKYLAAFAPRFW
251 PPAETRWVEANGNPAVLVTAGGNPVALLSVDASADGIERLMWVMNPEKLS
301 PYVTSLTA

>ECFp138505 ECF41 ECF41s10 Lentzea flaviverrucosa

1 MTQQLDEAESVFAAARPRLFGIAYRMTGSVADAEDLVQEVWVRWQLADRA
51 AVLNPEAYLATAVTRLAINESRTARARRETYVGPWLPEPVDTSADPQVGA
101 ERGAVLELAVLMLLEKLTPTERAAYVLREAFDYPYREIAEIVQTSEVATR
151 QLVSRARKHLADERRVPVERADQRKLLEAFVAAAQAGDLAALEELFAQDV
201 VSYSDSNGAIRAAGRPLFGAASLAKIISGWAPSFWAGAEASFVEANGLTA
251 VRLRKDDGTYAVITVTASAEGIDQVLWLVNPEKLAAFQ

>ECFp138566 ECF41 ECF41s10 Arthrobacter sp. OV608

1 MDADAGSTDELETASTIFAEVRPRLFGIAYRMLGSVSEAEDVVQETWVRW
51 QTCDRSLVRHAPAFLATTATRLAINVGQSARVRRETYVGPWLPEPVDTSA
101 DPELGALHGEALEFAVLLILEKLSPTERAAYVLRQAFDYPYEQIAEVIQQ
151 TEGNARQLVSRARKRLAEEKRAEVSVSEQRQLLEAFLAAARTGNLAALEA
201 LFAADVVSYSDGGGKVRASKFPVVGRERVAKYYQAFASRFWLGVDTQPFM
251 ANGRPSARLVQDGVVFAVVTLTASADGIDRLLWTMNPDKLSGVTRAGA

>ECFp138590 ECF41 ECF41s10 Microbacterium sp. HM58-2

1 MQLPGRPEAVESVKVQARDDTGSPEDGLMTAVAVFDGQRRRLFGIAYRML
51 GTVADAEDIVQETWIRWQNADRADVQEPAAFLATIATRLSINVLQSARAQ
101 RETYIGPWLPEPVNTDDDPALGAERGEALQFAILLTLEKLTPTERAAYIL
151 REAFDYPYPRIAEVISSSVVNARQLVSRARAHLASPARSAVTPGHQRRLL
201 EAFLAAARKGDAIELERLFADDVVSYSDGNGVKLAARIPVIGRTRVASFV
251 AAFASHFWAGKTTDWVEVNGQPAVALRQEGTITTVLAVTASAKGIEQLLW
301 MMSPQKLGHVIAGGA

>ECFp138598 ECF41 ECF41s10 Micromonospora saelicesensis

1 MVGRGKDGALVDALAAFDAVRPRLFGIAYRMLGSVAEAEDIVQEAWLRWQ
51 QTERSQVRDPIGFLVTTTSRLALNAATSARARRELYPGPWLPEPVDTAAD
101 PTLQAERNESLELAVLLLLERLTPAERAVYVLREAFDYPFRRIGEVLDVS
151 EAYARQLGHRARTHLAQQRREPVGHADRDRLLHAFLAAARSGELTQLEEL
201 LAETAISYADGGGAVRAAQLPVVGRDNVARYVLGLIRKFGRDLSPEIVES
251 NGQAAILVSRPGTTVALVTIDASPAGIERVLIILNPQKLAQFQR

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more