ECF proteins of ECF subgroup ECF41s10

Displaying ECF 121 - 140 of 392 in total
Name Aliases LCA Taxa Group Subgroup
ECFp11035
  • hypothetical protein
  • B085_RS0107205
Streptomyces sp. BoleA5 ECF41 ECF41s10

>ECFp11035 ECF41 ECF41s10 Streptomyces sp. BoleA5

1 MQPGDAERDGSLDEAAAVFTALRPRLFGIAYRMLGSAAEAEDVVQDVWLK
51 WQATDRDAVENPTAFLTTATTRLAINVTQSARVRREGYVGPWLPEPVDTR
101 SDPALGAERGEAVEIAVLLLLERLTPTERAAYVLREAFDYPYREIAGVLD
151 LSEANSRQLVSRARKHIAAGRREQVGTAEHRRLLEAFVAAARAGDMAGLE
201 KLLATDVVNYGDGGGAVRNAAKVPVFGSAKVARFITAFAPRFWLDTDVVW
251 VEANGQTAALVIHAGTPMALLSITASERGIDQLMWVLNPAKLTGFSSVAA
301 GPAEPSA

>ECFp11124 ECF41 ECF41s10 Streptomyces sp. WM6386

1 MAVRPQLFGIAYRVLGSTSEAEDVLQEAWLRWQHADRGAVREPKAFLATV
51 TARLAINLAQSARVRRESYTDPWLPEPIDTRADPQLGAERAEALDLAVLF
101 LLEKLNPVERAAYVLREAFDYPYKQIAEMLETSEANTRQLVSRARKRISS
151 ERRKPVDATEHRRLMKVFLTAARTGDLAVLEDILTEDVVSYTDGNGLRGA
201 SRIPVVGLVHVSRYLAAFGPRFWPHKEIDWVEANGGPAALVSDGGTAVVL
251 LTLDISERGIERAMWVMNPEKLTRYVASLDN

Name Aliases LCA Taxa Group Subgroup
ECFp172762
Microlunatus soli ECF41 ECF41s10

>ECFp172762 ECF41 ECF41s10 Microlunatus soli

1 MPETSATGVDGLSEDEASGGAVSPSADRPNGLDRPDADAVFAEVRPRLFG
51 IAYRMTGSVADAEDLVQEVWIRWQATDRSAVRNPPAYLATAITRLAINTL
101 TTARARRESYVGPWLPEPVDTSADPQLGAERTAALDAALLLLMEKLTPTE
151 RAGYVLREAFDYPYEQIAEIVQTSEVAARQLVSRARKRLAEQRHRPVDAG
201 QHRRLLESFITAARTGDLPELERLFRADVVSYSDGGGTRVRGVAPIPVSG
251 ATTVARFLRAFAPRFWPGVTVDYVEANGGPAALLRRDGAVAAMVVLTVSD
301 GGIEQILWQLAPSKINGFTDDEVSGRPVE

>ECFp138464 ECF41 ECF41s10 Streptomyces mirabilis

1 MRARDDADSLDQATREFMAARPHLFGIAYRVLGSVVEAEDIVQDAWLRWQ
51 NTNRADIVEPTAFLATVTSRLAINLAQSAPKRRESYIGPWLPEPVDTRVD
101 PQLGAERAEALDLAVLHLMERLNPVERAAYVLREAFDYPYKRIADMLETS
151 EANTRQLVSRARKRLSAERREPVSPAAHRRLLEVFLSAAQTGNLSVLEDV
201 LTADVVSYSDGGGMRGASRIPVVGRSHVSRYLAAFAPRFWPQTDVRWVEA
251 NGWPAVLVSADGNSVALLSVDVSERGIERIMWVLNPAKLAPYVASLDS

>ECFp137999 ECF41 ECF41s10 Streptomyces mirabilis

1 MHDEPSPTASDLDEAVSVFVQHRARLFGIAYRVLGSVAEAEDVVQEVWLR
51 WQRTERSVVVSPVAFLSSTATRLAINVAQSARVRRETYIGPWLPEPIDTS
101 SDPEVGAQRAEALELALLLVLEKLSPTERAAYVLREAFDYSYPEIAHMLR
151 LSLVNARKIVSRARKHLSDEQRESVDTVEHRRLLNAFVSAARTGDVGSLE
201 ALLTPDAVSLSDGDGIRGAARVPVSGRARVANLATAYPRFWGSVGVEFVA
251 ANGRMGAMIYRDGEPSTFMTIAAESEGIYRVMWVFNPKKIAAFLNSRSRS
301 TTALSPAPSGA

>ECFp13903 ECF41 ECF41s10 Streptomyces sp. Root55

1 MHTEDDTGSLDRATRDFLAARPQLFGIAYRVLGSAVEAEDILQDAWVRWQ
51 KADRADIREPKAFLTTVTARLAINTAKSARVRRESYTGPWLPEPVDTSLD
101 PQVGAERAEAVELAVLLLLEKLNPVERGAYVMREAFDYPYSRIADILETS
151 EANARQLVSRARKHLAAERRERVSRTEHQRLLEVFLAAAQTGDLKVLEEV
201 LSADVVSYSDGGGARGASKIPVVGLAHVAPYLVAFAPRFWPGSDVRWVEA
251 NGRPAVLVTSEGNAVALLCVDVSAEGIDRIMWVMNQAKLAPYVASLDS

>ECFp17014 ECF41 ECF41s10 Streptomyces ambofaciens

1 MHAGQDLGSLEEATRQFVEARPRLFGIAYRVLGSAVEAEDVLQEAWMRWQ
51 KADRTDIVEPAAFLATVTTRLAINTAQSARVRREAYVGPWLPEPVDTSSD
101 PQVGAERAEAVEMAVLLLLERLNPVERAAYVLREAFDYPYKQVAAILETS
151 EGNTRQLVSRARKHLATERREQVSRSEHQRLLEVFLTAAQTGDLATLERV
201 LAADVVSYADGGGVRGASRIPVVGRPHVSKYLAAFAPRFWPQSDVRWVEA
251 NDRPAVLVRSEGKAVALLCIDASAEGIDRLMWVMNPDKLSPYEASLSG

>ECFp17071 ECF41 ECF41s10 Streptomyces sp. JHA19

1 MRDRDDSEPLDRTGDDRDSLERAMKDFVAARPQLFGIAYRMLGSAADAED
51 ILQETWLRWQRADRSGIREPAAFLTTVTTRLAINSTQSARKRRETYVGPW
101 LPEPVDTRADPQLGAERAEAVDLAVLLLLEKLNPRERAAYVLREAFDYPY
151 ERIAEILETGEPHTRQLVSRARKHLKAARREPVSDSAHRRLLETFLEAAR
201 TGTLTALEELLAEDVVSYADGGGMRGASRVPVAGRERVARYLAAFAPRFW
251 PHSRVRWVEANGRPAVLVWREGHPVALLCADVSDRGIERLMWVMNPAKLA
301 PYVAAVAD

>ECFp17861 ECF41 ECF41s10 Streptomyces peruviensis

1 MRAEDDAGSLDEAAKQFMAARPQLFGIAYRVLGSAVEAEDIVQDTWLRWQ
51 KTDRAEIREPAAFLATIAARLAINLAQSARMRRESYVGPWLPEPVDTRAD
101 PQLGAERAEALDMAVLLLLEKLNPVERAAYVLREAFDYPYKRIAYILETS
151 EANTRQLVTRARKHLAAERRKPVGADVHRRLLEVFLDAARTGSLSVLEDV
201 LEQDVVSYSDGGGTRGASRIPVVGRLRVAKYLAAFAPRFWPPTEVRWVEA
251 NGRPAVLVTAGGNPVALLSVDVSDRGIERVMWVMNPDKLAPYVASLTD

>ECFp12974 ECF41 ECF41s10 Rhodococcus fascians

1 MTDDGTAAFELARPRLFGIAYRMLGSAAEAEDVVQDVWLKWHATDRTTVR
51 NSLAFLTTVTTRLAINVTQSARVRRESYVGPWLPEPIDTRADPATVADND
101 ATVELAVLVVLERLPARERAAYVLREAFDYPYGQIADIVETTEANARQLV
151 TRARRHVADARPTPVDSDRHHRLLDAFLAAAKGGDLAALEKILAQDVVSL
201 SDGGGKVKAAARIPIVGRSRVAAFVAAFSSHFWIGTTTSFIQVNGRAAVL
251 IVRESTVTTLLTIDATEDGIGTVLWVMNPDKLHALPR

>ECFp12980 ECF41 ECF41s10 Microbacterium sp. H83

1 MSEAEGASTDLDTAMEVFAAQRRRLFGIAYRMLGTVADAEDIVQDTWIRW
51 QGTDRAQVNEPAAFLATVATRLSINVLQSAHTRRETYIGPWLPEPVNTDD
101 DPALGAERAEALQFAILLTLEKLTPTERAAYILREAFDYPYPRIAEIISS
151 SVVSARQLVSRARAHLSSTRQAAVEPAHQRRLLEAFLVAAQKGDAQELEK
201 LFADDVVSYTDGNGVKLAARIPVIGRRRVASFVAAFAHHFWIGKTIDWVE
251 VNGQPAATLVENGEVTTMVTVTTSDDGIEQLLWVMAPQKLGHVTAVGA

>ECFp13909 ECF41 ECF41s10 Streptomyces niveiscabiei

1 MGVGDDLDVAAKEFVAVRGRLFGIAYRVLGSAAEAEDVVQEAWVRWQGVE
51 RSEVEEPAAFLTTVTTRLAINVAQSARVRRETYVGTWLPEPVNTGADPQV
101 GAERAEALDLAVLFLLEKLNPVERAAYVLREAFEYPYRRVSEILETSEAN
151 ARQLVTRARRHLAAERREPVGPAEHRRLLEVFLAAARAGDLAVLEEVLTQ
201 DVVSYTDGNGMRGASRIPVVGIVHVSRYLAAFAPRFWPGTEVRWVEANGR
251 PAALVSEGGSVRVLLCVDVSALGVERILWVMSPEKLAPYLASL

>ECFp12999 ECF41 ECF41s10 Streptomyces sp. NRRL B-24720

1 MSSKNDPAEDVESLQEAEAVFRDVRGRMFGIAYRMLGSVSEAEDILQEVW
51 IRWQTYDRSKVQNAPAFLATTTTRLAINVLQSARVRRETYVGPWLPEPVD
101 TSSDPALGAERGEALEVAVLMLLEKLTPTERAAYVLRQAFDYPYEQIAEI
151 IGQTNANVRQLVSRARKHLAAEKRASVAADEHQRFLTAFVAAAQTGNVAA
201 LEELFAQDVVSYADGGGAVRASKFPVVGVHRVAKYIHAFADTFWSGATVE
251 QVETNGRASVRLYRDGDVFAVVTVGVSADGIDRVLWMMNPSKLSAVAT

Name Aliases LCA Taxa Group Subgroup
ECFp17489
  • ECF RNA polymerase sigma factor SigJ
  • sigJ_1
  • ... more
Microbacterium hydrocarbonoxydans ECF41 ECF41s10

>ECFp17489 ECF41 ECF41s10 Microbacterium hydrocarbonoxydans

1 MGAEDVNLDERAWADEDRDVCTELDDALTTFGAHRRRLFGIAYRMLSTVA
51 DAEDIVQEAWIRWQNTDRSKVQEPIAFLTTIVTRLSINVLQSSRVRRETY
101 IGPWLPEPVNTEDDPALGAERAEALQFAILLTLEKLTPTERAAYILREAF
151 AYPYPRIAEVISSSPASARQLVSRARAHLASAKQATVDPGAQRRLLEAFL
201 TAAQKGDVRELESLFAADVVSYTDGNGVKLAARIPVSGRRRVARFVSAFS
251 HHFWTDKSIAWVEINGQPAAALTEDGQVTTVVTVTTSSDGILQLLWVMSP
301 EKLRHAAVGA

>ECFp13127 ECF41 ECF41s10 Mycobacterium sp. 852013-50091_SCH5140682

1 MTDLADAEEVFTGVRPRLFGLAYRMLGSVAEAEDVLQDAWVRWQATDRDD
51 VREPVAFLVTMVTRMCVNVLQSARVRRETYIGPWLPDPVDTSADPALGAE
101 RGEALQVATLMLMEKLAPPERAAYILREAFDYPYELIGETIAVTDVNARQ
151 LVSRARRHLAARRGEPVGTEEQRRLLTAFVAAAQTGDMSDLEELLASDVA
201 SYTDGNGMRNAAPVPVVGRQRVAKFVLAFRRRFWRNAAVTWITANGQAGA
251 LISQDGALAAFLTVAASAEGIEELLWVLSPDKLAHIATAVPDPAETV

>ECFp13147 ECF41 ECF41s10 Cellulomonas sp. Root485

1 MAAFEDVRPRLFGLAYRMLGSVAEAEDVVQDAWLRWQSTDRRVVRNPAAF
51 LTTTTTRLAINATTSAHARRETYIGPWLPEPVDTSADPALGAEKAEALEL
101 AVLLLLEKLGPTERAAYVLREAFGYSYREIADVLDTSEVNARQVARRARE
151 HLDSERSAPASPAQQRRLLESFVAAARAGDLDGLERLLVDDVVVRPDGGG
201 EVHASRVELVGAARTVTFLDNILRKYWQDSTLRIVEANGGAALLVTSETG
251 EPQAVVVLDGSERGIEHVYIVVSPSKMRQFA

Name Aliases LCA Taxa Group Subgroup
ECFp17967
  • hypothetical protein
  • SSP08S_RS18125
Streptomyces hokutonensis ECF41 ECF41s10

>ECFp17967 ECF41 ECF41s10 Streptomyces hokutonensis

1 MHVEPSPTRTDDLDEAVALFVRHRRRLFGIAYRILGSAVEAEDVVQEVWL
51 RWQKADRAAVVSPVAFLSTATTRLAINVAQSARVRRETYIGPWLPEPVDT
101 SADPALGAERAEAVELALLLVLERLTPVERAAYVLREAFAYGYAEIAQML
151 ELSVVNVRKIVSRARRHLLDERRESVDAAEHRRLLGAFVAAARTGDVASL
201 EALLTPDAVSLSDGNGVRGCARVPVLGRARVARLSVHRRFWREAEPEFVE
251 ANGSTGVVVRRDGRPLAFMTAAASKDGIHQLLWVFAPGKLAAVTGSRPGG

Name Aliases LCA Taxa Group Subgroup
ECFp13210
  • RNA polymerase sigma24 factor
  • IG98_RS0127315
Streptosporangium amethystogenes ECF41 ECF41s10

>ECFp13210 ECF41 ECF41s10 Streptosporangium amethystogenes

1 MNTESLEQADALDRAATAFIELRPRLFGIAYRMLGSAAEAEDIVQEVWLR
51 WQDTDRETIENPPAFLALVTTRLAINLAQSARVRRESYIGPWLPEPVDTS
101 LDPTVGAERGEALELAFLLLLERLNPTERAAYVLREAFDYPYPQIAEILR
151 LTPVNVRQIVSRARRRVTAVRHEPIDRLQHRRLLETFLDAAQTGNVGALE
201 KLFAADVVSSSDGDGIRGSAKFPVLGNERVARFVAAFSPRFWPGTAITWV
251 EMNGLPGVLVTRDGSGVALLAIEASKEGIHHLLWILNPAKIEAFERSRSR
301 IVTT

>ECFp13324 ECF41 ECF41s10 Micrococcales

1 MSSPVDTFEEQRGRMFGIAYRMLGSATEAEDVVQDAWLRWQSADRSDVLE
51 PGAYLATVVTRLSLTALDSARARREVYVGPWLPEPVSTTDDPLLGAERSE
101 AMSLAVLLLLERLTPAERAAYVLHEAFGYPFGRIAEVLETSEANARKLGS
151 RARAHLEREGGAQVSPAERDRLLAAFVAAAESGDLEALEAVLSEDVVTWS
201 DGGGVVSAARRPVVGRSRVAAFLLGLGEKFAGERAPYPLEANGQPGIMLS
251 RKDGFDAYMAFDVGPGGIRNILMVMNPSKLGRL

>ECFp13374 ECF41 ECF41s10 Streptomyces

1 MDARDASDSLDRATDEFLAARPQLFGIAYRVLGSAAEAEDVLQETWVRWQ
51 NTDRSAVKEPAAFLTTIAARLAINVAQSARVRRESYVGPWLPEPVDTRHD
101 PQLGAERAEALEMAVLLLLEKLNPVERAAYVLREAFDYPYKQVAEILETS
151 EPNTRQLVSRARKHLSAERKEPVSPADHRRLLEVFLAAAQTGDMRVLENV
201 LAADVVSYADGGGIRGASRIPVVGRLRVSKYLAAFAPRFWPPAETRWVEA
251 NGGPAVLVTAGGDPVALLSVDASEDGIRRIMWVMNPEKLAPYVTSLAA

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more