ECF proteins of ECF subgroup ECF41s10

Displaying ECF 101 - 120 of 392 in total

>ECFp11655 ECF41 ECF41s10 Saccharothrix sp. NRRL B-16348

1 MDDLEEAAAVFMGVRPRLFGIAYRMLSSATEAEDLVQEVWLRWQTCDRSV
51 VVNPAAFLATTATRLAINALQSARVRRETYVGPWLPEPVDTSADPYLGAE
101 RGEALEFAALMLMEKLTPNERAAYVLREAFDYSYAQIADILQSTEPAVRQ
151 LVSRARKHMAGERRTPATAAAQRELLSTFITAARTGDMAALERLLSADVT
201 SLSDGNGKLGVARKVLVGVPAVTQFMNAITWFWDGLDVRWVSANGQVSAV
251 LRRNGVEFGVLAVSTTTDGIDRVLWMLNPEKIAAVSDVSESPTSQSPLLP
301 GHEGRLRQS

>ECFp13303 ECF41 ECF41s10 Cellulosimicrobium cellulans

1 MTSHPTVPGRPGVLEDPGALDAFLAVRPRLFGLAYRMLGSVAEAEDVVQD
51 AWVRWQGTDRSRVENPAAFLTTTATRLAINAATSARARRETYVGPWLPEP
101 VDTSDDPALGAERAEALELATLVLLERLTPVERAVYVLREAFGYPHRRVA
151 EILDMSEANARQLARRARERLGARQAAPVDPGEHRRLLDEFVAAAHDGDM
201 ARFEQFLADDVVARPDGGGKVHASRKELVGVERVSLFFDNVWRKYWAGAD
251 LHVVEANGLPALLVVREGVPFALVSLDVSPAGIEHVYVQVNPDKLGGYAT
301 AA

Name Aliases LCA Taxa Group Subgroup
ECFp11775
Sorangium cellulosum ECF41 ECF41s10

>ECFp11775 ECF41 ECF41s10 Sorangium cellulosum

1 MTAPRVPEGPQPAADPFFALRPRLLGIAYRILGSRAEADDVVQDTWVRWQ
51 ATDRATVQEPTGFLVTATTRLAINVAQSARVRREAYVGPWLPEPIDTSPS
101 AELGAETQEGLALAVLVLLEKLSPTERAVYVLREVFDYPYEEIAGILDLG
151 EANVRQLLVRARKHLAGERRAPVGVEQQRRLLESFVAAAQKGDLSALERL
201 FAADVASTTDSNGRVRMAVRVPVHGRERVAKLVAGFSSRFWPGTTVTWLE
251 TNGQPSVLIRRDGVAVALASIDASAEGIEQIYWMMSPEKLATF

Name Aliases LCA Taxa Group Subgroup
ECFp11864
Tsukamurella pulmonis ECF41 ECF41s10

>ECFp11864 ECF41 ECF41s10 Tsukamurella pulmonis

1 MTDHDAVFEALRPRLFGVAYRILASAPDAEDVVQDGWLRWRAAERDAVRD
51 PEAFLVVTVTRLALNAAQSARARREQYVGEWFPTPVDTAADPALGAERTE
101 ALELAVVHVLQRLAPEARAAYVLREAFDHPYARIAEILQMREPAVRKLVS
151 RARTQVAGERRTTATRARARALLDAFLAAAHAGDVAGLEAVLVADVVSET
201 DGGGARRAGRRPVVGGNAVARFVAGFSVRFMADTTARIVEVNGLPGAVFT
251 LDGAPVALLCPTASDDGLTRLMWVMNAEKLADFA

Name Aliases LCA Taxa Group Subgroup
ECFp11895
Streptomyces iakyrus ECF41 ECF41s10

>ECFp11895 ECF41 ECF41s10 Streptomyces iakyrus

1 MDQQSPLSDDTLNAAADAFERQRPRLFGIAYRVLGSVSDAEDVVQDVWVR
51 WQDADRSAVLDEGAFLARITTRVAINVARSARVRREAYVGPWLPEPVDTG
101 VDPQVGAERGEALELAVLLVLERLNPVERAAYVLREAFDYAYDEIAGMLE
151 LSPVNTRQIVSRARKRLSAERREPVDTAQHRRLLDAFVAAAREGDVAALE
201 SVLSADVVAYADGNGMRGVARVELVGPARVARVTAFAHTFFPGAEYGVVE
251 ANGQPSLLLVEDGAAVALVSVTVGPDGIDGLYWVLAPEKLRAYERSARRV
301 TDRP

Name Aliases LCA Taxa Group Subgroup
ECFp11927
  • RNA polymerase sigma24 factor
  • DZ96_RS0221650
Actinomadura madurae ECF41 ECF41s10

>ECFp11927 ECF41 ECF41s10 Actinomadura madurae

1 MGPAERDDLGEAAAVFAGVRPRLFGIAYRMLGSATEAEDLVQDVWLRWQT
51 TDRGTVAEPAAFLATATTRLAINVLRSARVRRETYVGPWLPEPVDTGADP
101 HLGAERGEALSLAILFLLEKLSPTERAAYVLREAFDYPYPQIAEIVQVSD
151 VAVRQLVSRARKHLRSERRAPVTGAERRRLLTAFVAAARTGDLTALEAIL
201 AADVISYSDGGGAVRASRFPVVGAFRVAKYVRAFADRFWDGVDVQWAHVN
251 GQEAALLHREGELFTVLAVDASGPRIDRVLWMMNPAKITAASAG

Name Aliases LCA Taxa Group Subgroup
ECFp11676
  • RNA polymerase sigma24 factor
  • A3CQ_RS0110690
Actinoplanes globisporus DSM 43857 ECF41 ECF41s10

>ECFp11676 ECF41 ECF41s10 Actinoplanes globisporus DSM 43857

1 MAGDLDQAAKIFTEVRPRLFGIAYRMLGSAAEAEDLVQDVWLRWQAYDRD
51 TVENPGAFLATTTTRLAINELQSARARRETYIGPWLPEPVDTGADPYLGA
101 ERGEALEFAVLMLMEKLTPTERAAYVLREAFDYPYSQIASILQSTEPAVR
151 QLVSRARKHVTGERKAPVSEVVQRELLATFLEAARTGDLEELEKLFAADV
201 ASVSDGNGARNVSRKIVVGAARVAKFIAAFSSWYWEGVEIRWITANGQPS
251 AVLTRKGELLGVVSLTASADGIDELFWMLNPEKLGAVTNEGGPLS

>ECFp12280 ECF41 ECF41s10 Cellulosimicrobium funkei

1 MDERAADLTTAEQQFSAARRRLFGIAYRILGSAAEADDVLQDAWVRWQTY
51 DRSTVRNPDAFLTTTVTRLAINVAQSARVRRETYIGPWLPEPVDTSADPT
101 LGAERGEALEVALLMLLEKLTPTERAAYVLREAFDYPYEQIAEIIGHSQA
151 SVRQLVSRARRHLGEERRAPVAPEAQRRLLTAFVAAAKAGDVALLEQLFA
201 EDVISYSDGGGAVRASKFPVVGRPRVAKYHHAFAERFWAGVEVESADVNG
251 HPAVKLSRDGELFAVLTVRATTDGIDRVLWMMNPQKLAAVSA

>ECFp12411 ECF41 ECF41s10 Promicromonospora kroppenstedtii DSM 19349

1 MSQLSQAAEVFESNRRRLFGIAYRMLGTVADAEDIVQDAWLRWQATDRSV
51 VLNTEAFLVTTVTRLSINAVTSARVRRESYIGPWLPELVPTGDDPSLGAE
101 RAEALSVAMLTLMEQLSPSERAVYVLREAFDYPFRQIAEVLETSEANARQ
151 LARRARDHLAGQRRAPAQHQEISRLLDAFLSAARSGNLDELERLLAQDVV
201 SISDGGGKVTAARQPVTGRDRVARFLLGALRQFGQGATFEISDANGGSCL
251 LIEQGDELLAMATVSSGEGVIDGIYLVRNPDKLGSVQSS

>ECFp12022 ECF41 ECF41s10 Cellulosimicrobium

1 MSVRSRLFGIAYRMLGSATEAEDVVQEAWVRWQGTDRSVVRNPAAFLTTT
51 VTRLAINAATSARARRETYVGPWLPEPVDTSDDPALGAERAEALEIATLV
101 LLERLAPVERAVYVLREAFDYPYRRVAEILGLTEANARQLARRARERLGA
151 RPAVPVDPGEHRRLLDEFVAAAHDGDLARFERYLADDVVARPDGGGKVHA
201 SRVELVGLARVSLFLDNVWRKYWADAVVHVVEANGRPALLVVVDDAPFAL
251 VSLDVTARGIEHVYLQVNPEKLGGYAAAG

Name Aliases LCA Taxa Group Subgroup
ECFp12039
Streptomyces sp. AA4 ECF41 ECF41s10

>ECFp12039 ECF41 ECF41s10 Streptomyces sp. AA4

1 MEEIAEAASVFAQVRPRLFGIAYRMLGSVADAEDLLQDVWLRWQTCDRSV
51 VRDPGAFLATATTRLAITASQTARVRHETYVGPWLPEPIDTSADPQLGAE
101 RAAALEVAVLFLLEKLPPTERAAYVLREAFDYPYQQIADIVQTTEGNARQ
151 LVSRARKHLAAERRTPVEPAEQRRLLEAFVAAARSGDLATLEKLLAEDVV
201 SYSDGGGAVRATRIPVVGAGTVAKYVRAFANRFWPGTEVRWSEVNGQPAA
251 VVSHGGTVTAVLTVSASAEGIHRVFWLMNPAKLGAYAA

>ECFp12534 ECF41 ECF41s10 Nocardia yamanashiensis NBRC 100130

1 MSPRPLPPEPSGYVTDFQGLRPRLFGIAYRVLGRAADAEDVVQDVWLRWQ
51 GADRAVVRDRVAFLVTITTRLTLNAAGSARARREISVDHWLPGQVLDAED
101 PARATERSADLEQAVLLLLQRLSPTERAVFVLREAFDYPFRDIAQRLRIS
151 EANARQLGRRARTHLAGPRREPVPRAARDRLLSAFLEAARSGAVVNLERL
201 LTDDVVTSRS

>ECFp12537 ECF41 ECF41s10 Streptomyces sviceus ATCC 29083

1 MRPRLFGIAYRILGSVSEAEDVVQDVWLRWQDTDRNTVFNPGAFLAKITT
51 RLAINVAQSARVRREAYVGPWLPEPVDTSVDPQVGAERGEALELAVLLVL
101 EKLNPVERAAYVLREAFDYPYDEIAGIVQLTQANVRQIVSRARKRLSAER
151 RGPVDTAEHRRLLDAFVAAARHGDVAALESVLSADVVAYADGNGLRGVAR
201 LEVVGAGRVARISAFVDKLIPGAEFAFAEANGLPSLLIRKDGVTVGLVSA
251 TVGADGIDGLYWVLAPEKLRAYERS

>ECFp12542 ECF41 ECF41s10 Rhodococcus fascians 05-561-1

1 MTDDGTAAFELARPRLFGIAYRMLGSAAEAEDVVQDVWLKWHATNRTTVR
51 NSLAFLTTVTTRLAINVTQSARVRRESYVGPWLPEPIDTRADPATVADND
101 ATVELAVLVVLERLPARERAAYVLREAFDYPYGQIADIVETTEANARQLV
151 TRARRHVADARPTPVDSDRHHRLLDAFLAAAKGGDLAALEKILAQDVVSL
201 SDGGGKVKAAARIPIVGRSRVAAFVAAFSSHFWIGTTTSFIQVNGRAAVL
251 IVRESTVTTLLTIDATEDGIGTVLWVMNPDKLHALPR

>ECFp12550 ECF41 ECF41s10 Nocardia gamkensis NBRC 108242

1 MAIEPPRKDLAMSPMSTATALPESDLTQRPAPEETGLVTDFQCVRPRLFG
51 VAYRMLGRAADAEDVVQDVWLRWQRTDRAQVRDRLAFLVTITTRVSLNSI
101 GSARARREIPVDHWLPEHVTTVEDPSLVSERSAALEDAVALLLQRLSPTE
151 RAVFVLREAFDYSFRDVAERLGISEANARQLARRARLHLGRPRRAVVHPT
201 AHARLLNAFLAAAQDGAVTHLERTLAADITSAVAGG

Name Aliases LCA Taxa Group Subgroup
ECFp12563
  • RNA polymerase sigma24 factor
  • IH07_RS0112545
Actinocatenispora sera ECF41 ECF41s10

>ECFp12563 ECF41 ECF41s10 Actinocatenispora sera

1 MPEIETPDEELSDATAVFLAVRPRLFGIAYRMLGSAADAEDLVQEVWLRW
51 QRTDRSTVENPAAYLATAVTRLAINASRSARARHETYPGQWLPEPVDTSA
101 DPQLGAERGAALELAVLMLLEKLSPTERAAYVLREAFDYPYRQIADIVQT
151 TEVAARQLVSRARRRLAADRRKPVDRAQHERMLTAFVGAARSGDLAALEK
201 MLSADVVSTSDGGGLARATRMPVVGVDRVAKYVRAIGPRFWPGTEVSVVE
251 ANGQPVVLVRHGGEPVGLVALDVSADGIERLMWQINPEKLATFRAVSG

Name Aliases LCA Taxa Group Subgroup
ECFp12607
  • RNA polymerase subunit sigma-24
  • ASE68_04170
  • ... more
Agromyces sp. Leaf222 ECF41 ECF41s10

>ECFp12607 ECF41 ECF41s10 Agromyces sp. Leaf222

1 MDENLDDALAAFEAVRGRLFGIAYRMLGSAGEAEDIVQDAWLRWQGTDRT
51 VVENPPAFLATTTTRLAINALQSAHARRETYIGPWLPEPVDTSADPTLGA
101 ERAEALGFAVLVMLEKLTPTERAAYVLREAFAYPYDQICEIVQVSEPAAR
151 QLVSRARKHLAGETRREVSRHEQRRLLTAFLSAAKTGDLVELERLFAEDV
201 VSYSDGGGRVRASKFPVVGRLRVAKFVRAFRTHFWEGVEITEAETNGQPS
251 VMLSKEGTTFAVLTVVAGAHGIDQLLWMMNPEKLGAVASRAA

Name Aliases LCA Taxa Group Subgroup
ECFp12713
Leifsonia sp. 109 ECF41 ECF41s10

>ECFp12713 ECF41 ECF41s10 Leifsonia sp. 109

1 MEQDDLDTAAATFAAVRPRLFGIAYRMLGTVADAEDIVQDTWERWQRTDR
51 SAVREPAAFLATAATRLAINQAQSARVKRETYIGPWLPEPVDTSADPSLG
101 AERGEALEFAVLVLLEKLTPTERAAYVLREAFDYPYPQIAEIIQGSEASA
151 RQLVSRARKHLAEERHVREVDHAQQKRMLEAFLEAAQSGDIAELERIFTA
201 DIVSYSDGGGLARASRIPVFTRETVAKYVHAFADRFWDGTVRLIEANGGP
251 AAVLVRDGAVVAFIALDVTVDGIRRLQWVLNPQKLERIPVPA

Name Aliases LCA Taxa Group Subgroup
ECFp13508
  • RNA polymerase, sigma subunit, ECF family
  • RNA polymerase sigma24 factor
  • ... more
Cryptosporangium arvum DSM 44712 ECF41 ECF41s10

>ECFp13508 ECF41 ECF41s10 Cryptosporangium arvum DSM 44712

1 MDVPSDATDLESAAQVFADVRPRLFGIAYRMLGSVAEAEDLVQDVWLRWQ
51 LYDRSAVRNPAAFLATTTTRLAINALTSARARRETYVGPWLPEPVDTSAD
101 PYLGAERGEALEFAALLLMEKLSPAERAAFVLREAFDYPYAQIAEILQSS
151 EPAVRQLVSRARKHVAGERRTPVSPAAQRELLAAFLDAARSGDLAGLERL
201 FAPEVASVSDGNGGYRVARTVIVGATRVAKFLTAISGWFWDDVEVGWAQT
251 NGQTSAVLRRDGRVYGVLAISASADGVDQVLWMVNPEKITAVT

>ECFp10671 ECF41 ECF41s10 Streptomyces graminilatus

1 MDEAAQVFEGLRPRLFGIAYRVLGSVSEAEDVVQDAWLRWQGTDRSAVLA
51 PGAFLAKTTTRLAINVAQSARVRREAYVGPWLPEFVDTGVDPQVGAERGE
101 ALEVAVLLVLEKLNPVERAAYVLREAFDYPYDEIADMLRLAQANTRQLVS
151 RARKRLSAERRDPVDAAAHRRLLEAFVAAARHGDVAALENVLSADVVAYA
201 DGNGMRGVARLEVTGTGRVARISAFAQKFFPGADYGLVEANGHPAMLLTK
251 DGTAVALMSVTVGPDGIDGLYWILTPEKLRAYERSARRTKR

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more