ECF proteins of ECF subgroup ECF41s10

Displaying ECF 81 - 100 of 392 in total

>ECFp10486 ECF41 ECF41s10 Herbidospora mongoliensis

1 MDSLENAASVFTELRPRLFGIAYRMLGSAAEAEDVVQDVWLRWQVADRSA
51 VQSPPAFLATIATRLSINVAQSARSRRESYIGPWLPEPIDTSMDPTLGAE
101 RGEALEFAFLLLLERLSPTERAAYVLREAFVYPYEQIAEIIQVSAANARQ
151 LVSRARKRLSTERREPIDRTAHRQLLETFLDAAQSGDVHALESLFAKDVV
201 SLTDGNGILGAARLVMSGVPRVTKFITAFAPRFWPGATITYVEANGQPAV
251 YVPARDKIGGALLILDASPDGIHHLLWVMNPDKLSLYERSRHPGEPT

>ECFp10501 ECF41 ECF41s10 Streptomyces torulosus

1 MDEAAEVFQRLRSRLFGIAYRVLGSVSEAEDVVQEAWVRWQGADRAAVLD
51 PGAFLAKATTRLAINVAQSARVRREAYVGPWLPEPVDTSVDPQVGAERGE
101 AVELAVLLVLQKLNPVERAAYVLREAFDYPYDDIAGMLQVTRANTRQIVS
151 RARKRLAAERRDPVDTAEHRRLLEAFVAAARHGDVAALEGVLSADVVAYA
201 DGNGMRGVARLEVTGAGRVARISAFARKFFPGADYDVVEANGRPSLRLVR
251 DGATVALVSATVGPDGIDGLYWILTPAKLRAYERSAHRVSPA

Name Aliases LCA Taxa Group Subgroup
ECFp12896
  • RNA polymerase sigma24 factor
  • IG98_RS0122065
Streptosporangium amethystogenes ECF41 ECF41s10

>ECFp12896 ECF41 ECF41s10 Streptosporangium amethystogenes

1 MHALERAATAFTELRPRLFGIAYRMLGSATEAEDIVQEVWLRWQDTDRAA
51 IENPSAFLALITTRLSINVAQSARVRRESYIGPWLPEPVDTSLDPAVGAE
101 RSEALEFAFLLLLERLTPTERAAYVLREAFDYPYPQIAEILQLSTVNVRQ
151 LVSRARKHLTAVRREPVDRTEHRRILAAFVDAAQTGNIGALEGLLAADVV
201 STSDGNGLKGAARFPMLGCNRVARFVAAFAPRFWPGAEITWVEMNGRAGV
251 LVPRGRRGITLLTIDASPSGIHHLMWIVNPAKIEAFERSRARGGHP

>ECFp10760 ECF41 ECF41s10 Streptomyces antibioticus

1 MTSDDSGTAPPSRATSGLDDAVSVFLRHRGRLFGIAYRVLGSVTEAEDVV
51 QEVWLRWQKTDRAVVDNPMAFLSTTATRLAINVAQSARVRRESYIGTWLP
101 EPVDTSADPEVGAERAEAVELALLLVLERLNPTERAAYVLREAFDYGYPE
151 IAEMLRLNPANVRQIVSRARRHLLDDARETVDTAEHRRLLDAFVAAARTG
201 DVASLEALLTPDAVSLSDGNGIRGCARVPVLSAAHVAKLSSRRMLWHDAE
251 TEAVTANGLPGALVSREGRPVAFLTVVASKDGIHQVLWVFNPDKIAAFLG
301 SRSRGTAALG

Name Aliases LCA Taxa Group Subgroup
ECFp10970
  • RNA polymerase sigma24 factor
  • TK50_14465
  • ... more
Micromonospora carbonacea ECF41 ECF41s10

>ECFp10970 ECF41 ECF41s10 Micromonospora carbonacea

1 MAEFVAVRPRLFGIAYRMLGSVAEAEDVVQDAWLRWQSAERGAVRNPAAF
51 LTTTTTRLAINAATSARAVRERYVGPWLPEPVDTSADPALGAERAEALDL
101 AVLLLLERLTPTERAAYVLREAFDYSHQQVGEVLDTSEVNARQLVSRARR
151 HLASQRSSPVSAARRRELVEAFLGAAREGDVAALERLLAEDVRAWSDGGG
201 RVNAARRELAGVERVTTFLDNVLRKYWHTAGFRFVEVNGGGALLVTNADG
251 SPQSLVALDCSDRGIERVLIVVNPDKLRGFAGDR

Name Aliases LCA Taxa Group Subgroup
ECFp11195
  • hypothetical protein
  • L617_RS20460
Cellulosimicrobium cellulans J36 ECF41 ECF41s10

>ECFp11195 ECF41 ECF41s10 Cellulosimicrobium cellulans J36

1 MSRTERTSIRDVAHGTTAERLRRDPDPQALADFLAVRPQLVGVAHRILGS
51 APEAEDVVQDAWVRWHGTDRSRVVNSAAFLTTVVTRLALNVRASARARRE
101 TGAGPWVPEPVDTSPDPSTCAERVEAIQVAALALLARLTPVERAIYVLRE
151 AFGYPHRHVAQILDLSEANTRQLARRARARLAQRDAVAVDPREHRRLVDE
201 LTAATHDGDLARFERFLAADVSASTDQPRRGRPRTIRRDARRAGSRPRRG
251 PRAPALATPQTADA

>ECFp11090 ECF41 ECF41s10 Streptomyces sp. NRRL B-1347

1 MDERRALTYDSLDEAADAFQRLRPRLFGIAYRVLGSVSEAEDVVQDVWVR
51 WQGADRGIVLDAGAFLAKITTRLAINVAQSARMRREAYVGPWLPEPVDTS
101 VDPQLGAERGEAVELAVLLVLQKLNPVERAAYVLREAFDYAYDDIAGMLR
151 LSQANTRQVVSRARKHLAAERREPVEAAQHRRLLEAFVAAARDGDVAALE
201 DVLSADVVSYSDGNGMRGVARLEVVGAARVARMSVFAKKYFPRAEYVLAE
251 ANGLPSLLLVQDAAAVALMSVTVGPDGIDGLYWILAPDKLRAYERSARAR
301 TSRP

Name Aliases LCA Taxa Group Subgroup
ECFp11276
  • RNA polymerase, sigma-24 subunit, RpoE, ECF subfamily
  • OK074_6833
Actinobacteria bacterium OK074 ECF41 ECF41s10

>ECFp11276 ECF41 ECF41s10 Actinobacteria bacterium OK074

1 MAGDTDPDLVREDEDGDGDGGDGDRGAGPEDLEEAAVVFTRVRPRLFGIA
51 YRMLSSVTEAEDLVQDVWLRWQNYDRAKVTNPAAFLSTTTTRLAINELRS
101 ARVRRETYIGPWLPEPVDTGADPYLGAERGSALELAVLILMERLSPNERA
151 AYVLREAFDYPYPQIADILRASEAAVRQMVSRARKRVAGERRTPVTAAEQ
201 RHLLTTFVTAARSGDLAALERLFAADVTSYSDGNGALGVARRPVVGVSRV
251 AEFFARAADRFWVGVEVRWVHTNGQPSALLRRDGTALAVLTVDASTEGIE
301 QLLWVFNPAKIAAVSVPAD

Name Aliases LCA Taxa Group Subgroup
ECFp11183
  • RNA polymerase subunit sigma-24
  • AQI70_08390
  • ... more
Streptomyces curacoi ECF41 ECF41s10

>ECFp11183 ECF41 ECF41s10 Streptomyces curacoi

1 MDERQPVGHDSLNEAADAFQRLRPRLFGIAYRVLGSVSEAEDVVQDVWVR
51 WQGADRSAVLDPGAFLAKITTRLAINVAQSARVRRAAYVGPWLPEPVDTG
101 VDPQVGAERGEALELAVLLVLEKLNPVERAAYVLREAFDYPYEDIAGMLG
151 LSQTNTRQIVSRARKRLSAERRAPVDTAEHRRLVEAFVAAARHGDVAALE
201 EVLSADVVAYADGNGMRGVARLAIVGAERVARVTAFAGKFFPGADYAVAE
251 ANGRPGLRLVKDGVTVALVSVTVGADGVDGLYWVLAPGKLRAYERSAHRL
301 TGRP

Name Aliases LCA Taxa Group Subgroup
ECFp11345
  • RNA polymerase subunit sigma-24
  • G401_RS0139390
Hamadaea tsunoensis DSM 44101 ECF41 ECF41s10

>ECFp11345 ECF41 ECF41s10 Hamadaea tsunoensis DSM 44101

1 MDIRPEAVPGADAVEVFARVRGRLFGIAYRMLGSVTEAEDLLQDVWIKWQ
51 GYDRSTVAEPAAFLATVTTRLAINALQSARVRRETYIGPWLPEPVDTSAD
101 PYLGAERGEALSLAVLLLLEKLTPTERAAYVLREAFDYPYPQIAEIVQVG
151 EAAARQLVSRARKHLASQRRTPVSPADQRRLLTAFVAAARDGDLAALEQL
201 FAADVVSYADGGGAARASRIPVVGAATVARYVHAFAARFWSGVEIGWGEA
251 NGRPAALLGRDGRLFAVVTIDASADGIGQIQWMMNPAKLRSRP

>ECFp11262 ECF41 ECF41s10 Streptomyces sp. NBRC 110468

1 MRAGAHPDSFDRGLDDFLSARPRLFGIAYRILGSAVEAEDIVQDAWLRWQ
51 NTDRAQIHEPAAFLTTVTTRLAINLAQSARVRRESYVGPWLPEPVDTTQD
101 PHLGAERAEAVELAVLLLMEKLNPIERAAYVLREAFDYPYQRVADILETS
151 DANARQLVSRARKHLGAERKERVSPAAHRRLLEGFLSAARTGDLSVLENL
201 LTSDVVSYSDGGGIRGASRIPVMGRDHVSRYLAAFAPRFWPDAETRFVEA
251 NGRPAVLVERDNAPVALLCVDASEAGIERIMWVMNPVKLNPYVLSLGA

>ECFp11394 ECF41 ECF41s10 Cellulosimicrobium funkei

1 MAGVDERAADLTTAEQQFSAARRRLFGIAYRILGSAAEADDVLQDAWVRW
51 QTYDRSTVRNPDAFLTTTVTRLAINVAQSARVRRETYIGPWLPEPVDTSA
101 DPTLGAERGEALEVALLMLLEKLTPTERAAYVLREAFDYPYEQIAEIIGH
151 SQASVRQLVSRARRHLGEERRAPVAPEAQRRLLTAFVAAAKAGDVALLEQ
201 LFAEDVISYSDGGGAVRASKFPVVGRPRVAKYHHAFAERFWAGVEVESAD
251 VNGHPAVKLSRDGELFAVLTVRATTDGIDRVLWMMNPQKLAAVSA

>ECFp11316 ECF41 ECF41s10 Streptomyces sp. Tu 6176

1 MQADDDRSSPDSPGSAPDSSGSSLDRAARDFIAARRQLFGIAYRVLGSAA
51 EAEDVVQEAWVRWQNTDRSGVREPLAFLTTVTTRLAVDVARSARVRRESY
101 VGPWLPEPVDTRSDPQLGAERAEAVELAVLLLLEKLNPVERAAYVLREAF
151 DYPYRRIADILETSEPHTRQLVSRARGHLADGRREPAGPAAHRRLLEVFL
201 GAARTGDLAVLEDVLAADVVSYSDGGGVRGASRIPVVGRTRVAGYLAAFA
251 PRFWPAARVRWTEANARPAVLVSFDGEPAALLSVDVSERGIERIMWVMNP
301 AKLLPYAASLDGGED

Name Aliases LCA Taxa Group Subgroup
ECFp11457
  • RNA polymerase sigma24 factor
  • ACTRO_RS14600
Actinospica robiniae DSM 44927 ECF41 ECF41s10

>ECFp11457 ECF41 ECF41s10 Actinospica robiniae DSM 44927

1 MNTDGNEESLDRAVRDFEAARPRLFGIAYRILGSAVEAEDVVQESWLRWQ
51 NAERADIREPAAFLATVTTRLAINAAQSAAARRESYIGPWIPEPVDTGAD
101 PQLGAERAEALDLAVLFLLEKLNPVERAAYVLREAFDYPYARIAEMLETS
151 EANTRQLASRARKRLAEERRQAVDSRTHRRLLKAFLGAAQAGDMSELEKV
201 LTQDVVSYADGGGVRGASRIPVVGRTRVARYLVAFAPRFWPPTEVRWVEA
251 NGRPAVLVTVEGAAVALLTADVSERGIERLLWVLNPDKLARYAASAAAG

Name Aliases LCA Taxa Group Subgroup
ECFp11475
Streptomyces canus ECF41 ECF41s10

>ECFp11475 ECF41 ECF41s10 Streptomyces canus

1 MHAEADANSLEQATQNFLAARPRLFGIAYRLLGSTVEAEDILQETWLRWQ
51 NTDRTKVVEPTAFLTTITTRLAINLAQSARVRRESYVGPWLPEPVDTVED
101 PQLGAERAEALELAVLFLLEKLNPVERGAYVLREAFGYPYPQIAGILEIS
151 EANARQLVSRARKHLAAERRERVSPSEHRRLLRVFLTAAQTGDLAVLEDV
201 LTADVVSYSDGGGTRGASKIPVFGRVHVSKYLAAFAPRFWPQSEIRWVEA
251 NSRPAVLISSGGAAVALLSVDVSVEGIDRIMWVMNPAKLSPYVASLNE

Name Aliases LCA Taxa Group Subgroup
ECFp11424
Jiangella muralis ECF41 ECF41s10

>ECFp11424 ECF41 ECF41s10 Jiangella muralis

1 MTTDGVAEFLDVRPQLFGIAYRMLGSVAEAEDVVQDAWIRWQRTNRDEVE
51 NPAAFLTTTVTRLALTAATSARARRETYPGAWLPEPVDTSDDPALGAERA
101 EALDLAVLLLLERLSPAERAVYVLHEAFDYPYRRIGEILEISEPHARQLA
151 RRARLALESGRAAPAPPGLRRRLVETFAAAARDGDLEALERLFTEDVAAR
201 ADGGGKVHVSRVDLHGVERVVLYLDNILRKFWSEASFTVVDANGGGALLV
251 TDAAGAPLAVLALDVSGRGIERVLFVVNPDKLRGFGRQ

>ECFp10358 ECF41 ECF41s10 Streptomyces sp. NRRL S-646

1 MSTGDDTDSLDEATKVFVAARPQLFGIAYRVLGSTAEAEDVLQEAWLRWQ
51 HTDRAAVREPRAFLTTVTARLAINLAQSARVRRESYTGPWLPEPVDTGAD
101 PLLGAERSEALDLAVLFLLEKLNPVERAAYVLREAFDYPYQDIAEMLETS
151 EANTRQLVSRARRRLSSDRRRPVSAAAHRRLMGVFLAAAQTGDLAVLENV
201 LTEDVVSYSDGGGIRGASRIPVMGRLRVSKYLAAFAPRFWPDKGVRWVEA
251 NGGPAVLVLADGVAVALLALDVSERGIERIMWVMNPQKLAPYMASLDGGG
301 TE

>ECFp11504 ECF41 ECF41s10 Cryobacterium arcticum

1 MRGNRSDAAASEIDDVADEFESLRPRLFGIAYRMLGSTVEAEDIVQDAWV
51 RWQCTDRTGIRSPAAFLTTMTTRLSINVATSSRLRRETYIGPWLPEPVLT
101 GADPELGAENTEALEVGILLLMERLTPMERAVYLLHEAFDYPYREIGEII
151 GTTEANARQLSRRARQHLTESTGTRVTVAEKNRLLRSFLAAAQSGDVQRL
201 QTLLTDDIVLYSDGGGIVSAARRPVEGRDHVGRFLLGTLRKLEDNVDMQL
251 TSVNGSDAFVFRKDGAPYIVCSIGVNEHGINRIFFVLNPQKLGALR

Name Aliases LCA Taxa Group Subgroup
ECFp11641
  • RNA polymerase sigma24 factor
  • RS82_RS03460
Microbacterium trichothecenolyticum ECF41 ECF41s10

>ECFp11641 ECF41 ECF41s10 Microbacterium trichothecenolyticum

1 MDPDDIALAVTVFDEHRRRIFGIAYRMLGTVADAEDIVQETWIRWQNADR
51 AEVREPGAFLATVATRLSINATQSAHARRETYIGPWLPEPVNTDADPALG
101 AERGEALQYAILLVLEKLTPTERAAYILREALDYPYERIADVIGATVASA
151 RQLVSRARRHLESARKAEVAAAEQRRLLEAFLVAAQKGDVGDLERLFAED
201 VVSYTDGNGFKLAARVPVAGRGRVAKFVAAFSSHFWTGKQIGWVEVNGRP
251 AATLSEDGEVTTLVTVTAAEDGIRRLLWVMSPEKLGHVAQVGA

>ECFp11650 ECF41 ECF41s10 Amycolatopsis orientalis DSM 46075

1 MEEIAEAASVFAQVRPRLFGIAYRMLGSVADAEDLLQDVWLRWQTCDRSA
51 VRNPGAFLATTTTRLAITASQTARARHETYVGPWLPEPVDTSADPQLGAE
101 RAAALEVAVLFLLEKLPATERAAYVLREAFDYPYQQIADIVQTTEVSARQ
151 LVSRARKHLAAERRAPVEPAEQRRLLTAFVDAARSGDLATLEKLLAEDVV
201 SYSDGGGAVRATRIPVVGAVTVAKYVRAFADRFWAGAEVRWSDANGQPAA
251 VVSHGGTVTAVLTATASAEGIHRVFWLMNPAKLGAYPA

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more