ECF proteins of ECF subgroup ECF41s10

Displaying ECF 61 - 80 of 392 in total

>ECFp16003 ECF41 ECF41s10 Actinospica acidiphila

1 MDVRDASESLDRATEDFLAARPQLFGIAYRVLGSAAEAEDVLQETWVRWQ
51 NTDRSGVKEPAAFLTTITARLAINVAQSARVRRESYVGPWLPEPVDTRHD
101 PQLGAERAEALEMAVLLLLEKLNPVERAAYVLREAFDYPYKQVAEILETS
151 EPNTRQLVSRARKHLSAERKEPVSPADHRRLLEVFLAAAQTGDMRVLENV
201 LAADVVSYADGGGIRGASRIPVVGRLRVSKYLAAFAPRFWPPAETRWVEA
251 NGGPAVLVTAGGNPVALLSVDASEDGIHRVMWVMNPEKLSPYVTSLTA

>ECFp11449 ECF41 ECF41s10 Streptomyces sp. NRRL S-1521

1 MHTRGDADSLDQATKDFLAVRPRLFGIVYRVLGSAVEAEDIIQDVWLRWQ
51 KTDRSDILEPSAFLTTITTRLAINFSQSARVRRESYVGPWLPEPVNTAAD
101 PQVGAERAEALEMAVLLLLEKLNPVERAAYVLREAFEYPYRRIAEVLETT
151 EANTRQLVSRARKHLSAQRKERVNPADHRRLLEVFLDAARNGNLAELEQI
201 LATDVVSYSDGGGVRGASKIPVVGRTHVSRYLVAFAPRFWPQAQLRWTEA
251 NGRPAVLIASAGSAVALLSLDVSTEGIDRIMWIMNPAKLAPYVASLEG

>ECFp13404 ECF41 ECF41s10 Streptomyces sp. Root369

1 MSVEPSLTTPDDLEDAVAVFVHHRKRLFGIAYRILGSTVEAEDVVQEVWL
51 RWQKTDRSVVLSPAAFLSSATTRLAINVAQSARVRRETYIGPWLPEPVDT
101 GTDPEVGAERAEAVEMALLLVLEKLTPVERAAYVLREAFDYAYAEIADML
151 EVSLVNVRKIVSRARRHLLDERRESVDAAEHRRLLGAFVSAARTGDVASL
201 EALLAPDVVSLSDGNGMRGCARIPVRGRARVARLATYRQLWREAIPELVD
251 ANGATGVLVHRDGRTVAFMTAAVSKHGIHQVMWVFEPSKIAAFVASRSRF
301 AMSPGVVSDRV

>ECFp138006 ECF41 ECF41s10 Streptomyces gancidicus BKS 13-15

1 MAGDLSEAVSVFVELRPRLFGIAYRVLGSAVEAEDVVQEVWLRWQRTDRT
51 LVISPVAFLSSTTTRLAINVAQSARVRRETYIGPWLPEPVDTSNDPEVGA
101 ERAEALELALLLVLQRLSPTERAAYVLREAFDYAYPDIARILGLSPVNVR
151 KIVSRARKHLTEDQRDSVDAAEHRTLLQTFVAAARQGDVAGLEALLTPNA
201 VSLSDGNGIRGAARVPVLGRARVANLSTAHPRFWPTVEAEPVEANGRGGI
251 LIHRDGRPATFMTIAATSRGIHQVMWVFNPAKIAAFLDSRTRHRSAPALC
301 V

>ECFp13846 ECF41 ECF41s10 Streptomyces

1 MHAGGRPDTLDQATKDFLSARPRLFGIAYRVLGSAVEAEDVMQETWLRWQ
51 NTDRTKVLEPAAFLTTVATRLAINLAQSARVRRESYVGPWLPEPVDTTED
101 PQLGAERAEALEMAVLLLLEKLNPVERTAYVLREAFDYPYGRVSEILETS
151 EANARQLVSRARRHLAAERRERVTPAAHRRLLEVFLSAARTGDLSVLEDV
201 LTADVVSYSDGGGIRGASKIPVIGRPHVSRYLVAFAPRFWPQADIRWVEA
251 NGLPAVLISAGGNAVALLSVDISTEGIDRLMWVMNPAKLAPYVASLRD

>ECFp16179 ECF41 ECF41s10 Streptomyces sp. AcH 505

1 MHTDNDADSLDGATREFLAARPQLFGIAYRVLGSAAEAEDIVQDAWLRWQ
51 NADRTDIVEPKAFLATVTTRLAINTAKSARVRRESYVGPWLPEPVDTSQD
101 PQVGAERAEALELAVLLVLEKLNPVERAAYVLREAFDYPYGQVAEILETS
151 EANARQLVSRARKHLAAERKERVSPTELQRLLEVFLAAARTGDLKVLEDV
201 LAADVVSYSDGGGVRGASRIPVVGLPHVSQYLVAFAPRFWPEAEIRRVEA
251 NGGPAVLVLSGGNAVALLTIDASAEGIDRIMWMMNPAKLAPYVESLDG

>ECFp17059 ECF41 ECF41s10 Streptomyces sp. NRRL S-813

1 MYAGDEADSLDRATRDFIAARPQLFGIAYRILGSATEAEDIVQEAWLRWQ
51 NADRAGIHEPTAFLTTVTARLAINHAQSARVRRESYIGPWLPEPVDTSGD
101 PHLGAERAEALDLAVLFLLEKLNPVERAAYVLREAFDYPYQQIAEILETS
151 EANTRQLVSRARKHLSSQRREPVSSDAHRRLLEAFVAAAQTGDLSALEGV
201 LTADVVSYADGGGMRGASRIPVIGRPHVSKYVAAFAPRFWPERDVRWVEA
251 NGRPAALLSTGGTPVALLSIEVSAVGIERLMWVLNPTKLASYAASSDG

>ECFp17437 ECF41 ECF41s10 Streptomyces fulvoviolaceus

1 MVLEPSPTTSDLEEAVSVFVQYRNRLFGIAYRVLGSAVEAEDVVQEVWVR
51 WQNTDRSVVVSPVAFLSSTTTRLAINVAQSARVRRETYIGPWLPEPVDTS
101 SDPEMGAQRAEALELALLLVLEKLSPTERAAYVLREAFDYAYPEIAEILR
151 LSLVNVRKIVSRARKHLSEEQRESVDTAEHRRLLSAFVAAAQTGDVASLE
201 ALLTPDTVSLSDGNGMRGCARIPVLGRARVAKMVTYPKLWREAEPRLVDA
251 NGSTGVMVYRGGQPIAFMTMAASREGIHQLMWVFSPIKIAAFLGSRSRFA
301 TAGGPASGGV

>ECFp18791 ECF41 ECF41s10 Streptomyces caeruleatus

1 MRAEDDKGSLDRAAEQFMAARPQLFGIAYRILGSAVEAEDIVQEAWVRWQ
51 NTDRAEIREPAAFLATVTSRLAINLAQAARMRRESYTGPWLPEPVDTRAD
101 PQLGAERAEALDLAVLLLLERLNPVERAAYVLREAFDYPYKRIADILETN
151 EAHTRQLVTRARKHVAAERRQPVGDGVHRRLLEVFLDAARTGSLSVLEGV
201 LTDDVVSYTDGNGMRGASRIPVVGRPRVSKYLAAFAPRFWPPTEVRWVEA
251 NGRPAVLVTAGGDPVALLSVDVSARGIERVMWVMNPDKLAPYVASLAD

>ECFp12613 ECF41 ECF41s10 Lechevalieria aerocolonigenes

1 MPCRKWVTALELFSAARPRLFGIAYRMLGSALDADDLLQEVWLRWQDYDH
51 AEVRNPAAFLATITTRLAINAGKTARARHETYIGPWLPEPVDTSADPQLG
101 AERDAALEVAVLVLLEKLTPTERAAYVLREAFDYPYPQIAEIVQTSEAAA
151 RQLVSRARKHLAQERTTTVSTEEQRRLLTAFIAAAKNGDLAALEELLAED
201 VVSYADSNGKVRGASKVRLLGRSAVAKVVQTASPVFWAGAEATITPVNGR
251 LAAVVTRGGVPFCVINMVASDDGIDQLMWMMNTDKILQNRHFTLSM

>ECFp13173 ECF41 ECF41s10 Nocardia mikamii NBRC 108933

1 MLGRAADAEDVVQDVWLRWQRTDRAQVRDGLAFLVTVTTRVSLNSVGSAR
51 ARREIPVDNWLPGQVPVAEDPCSVSERSAVLSDAVALLLQRLSPTERAVF
101 VLREAFDYPFRDIAGQLGISEANARQLARRARAHLTEPRPATVSRTAHDR
151 LLTAFLAAARDGAVMPLERILAEDISAPAGRDGTTGPAGERRSRPLPGVT
201 NSTGPGSLLTEARGKAIP

>ECFp10815 ECF41 ECF41s10 Nocardia mikamii NBRC 108933

1 MTGTAPDADLDRALGDFSGLRPRLFGIAYRMLGTVADAEDIVQDAWVKWQ
51 SYPDRAAVQDTTAFLVTMTTRLAINATRTARVRRETYLGPWLPEPVDTGA
101 DPSLGAERAAALETAVLVVLEKMTPTERAAFVLREAFDYPYGKIAEVLEV
151 KEATARKLVSRARHGIASERHTPVDDEQQRRLLEAFLDAARAGDLDDLEA
201 LFATEVASYSDGGGKPVRASRVPVVGRDRVAKYVAAFASHFWTGVTLDRV
251 EANGRASVLISRDGEAVAWLTVGAADSEHIDRVYWILNPDKLSRLAQSVG
301 LTGGPAAQ

>ECFp18682 ECF41 ECF41s10 Streptomyces sp. NRRL F-5527

1 MDARDAADSLDRATDDFLAARPQLFGIAYRVLGSAAEAEDVLQEAWVRWQ
51 NTDRSGVKEPAAFLTTITARLAINVAQSARVRRESYVGPWLPEPVDTRHD
101 PQLGAERAEALEMAVLLLLEKLNPVERAAYVLREAFDYPYKQVAEILETS
151 EANTRQLVSRARKHLAAERKEPVSPADHRRLLEVFLAAAQTGDMRVLENV
201 LAADVVSYADGGGIRGASRIPVVGRLRVSKYLAAFAPRFWPPAETRWVEA
251 NGNPAVLVTAGGNPVALLSVDASADGIERLMWVMNPEKLSPYVTSLTA

Name Aliases LCA Taxa Group Subgroup
ECFp12705
  • RNA polymerase subunit sigma-24
  • GD1_RS19805
Gordonia desulfuricans NBRC 100010 ECF41 ECF41s10

>ECFp12705 ECF41 ECF41s10 Gordonia desulfuricans NBRC 100010

1 MEDAVQVFAGHRRRLFGIAYRMLGTVSDAEDIVQETWIRWQGTDRSRVTD
51 PAAFLTTITTRLSINVLQSARSHRETYIGPWLPEPVNTDDDPTLGAERAE
101 ALQFAILLTLEKLTPAERAAYILREAFDYPYPRIADILSTTVVNARQLVS
151 RARSHLASARHADVEPKHQRRLLRAFLTAAQKGDAQDLEELFADDVVSYS
201 DGNGIKLAARIPVVGRTRVAKFVAAFAHHFWTGKHIDWVQVNGQPAAALS
251 EEGTVTTVVVVTTSKDGIRQLLWVMSPDKLGHVTSVSV

>ECFp16318 ECF41 ECF41s10 Streptomyces sp. NRRL F-5122

1 MRAGDDAGTLEQATKDFMAARPRLFGIAYRVLGSVVEAEDIVQEAWVRWQ
51 NADRSDVHEPAAFLSTITTRLALNSAQSARTRRESYVGPWLPEPVDTSMD
101 PQLGAERAEALDLAVLHLLEKLNPVERAAYVLREAFNYPYKQIADMLETS
151 EANTRQLVSRARKHLSAERKEPVSSAAHRRLLEVFLSAAQTGDLSALEQL
201 LTADVISYSDGGGMRGASRIPVVGRPHVSKYLVAFAPRFWPQREIRWVEA
251 NGRPAALVMDDGEPVALLSLDASERGIERLMWVLSPSKLAPYVASLKG

Name Aliases LCA Taxa Group Subgroup
ECFp1638
  • RNA polymerase sigma factor
  • putative RNA polymerase sigma factor
  • ... more
Streptomyces ECF41 ECF41s10

>ECFp1638 ECF41 ECF41s10 Streptomyces

1 MAGDLSEAVSVFVELRPRLFGIAYRVLGSAVEAEDVVQEVWLRWQRTDRT
51 LVISPVAFLSSTTTRLAINVAQSARVRRETYIGPWLPEPVDTSNDPEVGA
101 ERAEALELALLLVLQRLSPTERAAYVLREAFDYAYPDIARILGLSPVNVR
151 KIVSRARKHLTEDQRDSVDAAEHRTLLQTFVAAARQGDVAGLEALLTPNA
201 VSLSDGNGIRGAARVPVLGRARVANLSTAHPRFWPTVEAEPVEANGRGGI
251 LIHRDGRPATFMTVAATSRGIHQVMWVFNPAKIAAFLQSRTRHRSVAALC
301 V

Name Aliases LCA Taxa Group Subgroup
ECFp11788
Rhodococcus opacus ECF41 ECF41s10

>ECFp11788 ECF41 ECF41s10 Rhodococcus opacus

1 MDAKLLDTYTDDGGRAISDLDQAASAFLSVRPRLFGIAYRILGSASEAED
51 IVQEVWIRWQGTDRTVVINSSAFLATTTTRLAITLAQSARKRHEIYDLHR
101 LPEPVDPQVDPATGPELREEVQSALLILEDLTPSERAAYLLREAFDYPYR
151 KISEVLQLGVANARQLVRRARNRIAARREHRGHRAAMNLVAHRRLVRAFL
201 SASQAGNFADLEELLAKDVIDPSRPGMESRKPMRSMTDREFWRHVQQDTD
251 DELLADIDNPARTPEQHDALVHALLARKDAHDAAERLADNHERWPWVRPN
301 YFDTDIDFATAAVV

>ECFp16545 ECF41 ECF41s10 Streptomyces sp. NRRL S-646

1 MHHESSLATTDDLDEAVSVFVQHRRSLFGIAYRMLGSAAEAEDVVQEVWL
51 RWQKTDRSAVVNPRAFLSSAATRLAINVAQSARVRRETYIGPWLPEPVDT
101 SADPEVGAERAEALEMALLLVLEKLSPTERAAYVLREAFDYAYAEIADIL
151 ELSLVNVRKIVSRARRHLSGERRESVEADEHRRLLSAFVSAARTGDVASL
201 EALLTVDAVSLSDGNGMRGCARIPVLGRARVAHLATYRPLWREAEVGLVD
251 ANGLTGVLLHRDGEPTAFMTMAASKEGIHQLMWVFSPSKIAAFLDSRTRF
301 STAAALTPDAMDSRTAVCRG

Name Aliases LCA Taxa Group Subgroup
ECFp10411
  • RNA polymerase subunit sigma-24
  • OP79_RS28700
Streptomyces yerevanensis ECF41 ECF41s10

>ECFp10411 ECF41 ECF41s10 Streptomyces yerevanensis

1 MEGDLHEAVSVFVKLRPRLFGIAYRVLGSAVEAEDVVQEVWLRWQHTDRA
51 VVVSPVAFLSSATTRLAINVAQSARVRRETYIGPWLPEPIDTSNDPQAGA
101 ERAEALELALLLVLEKLPPTERAAYVLREAFDYSYPEIAQILGLSPVNVR
151 KIVSRARKHLTEDQRDSVDATEHRRLLDAFVTAARQGDVASLEALLTSDA
201 VSLSDGNGMRGAARVPVLGRARVANLSTAYPRFWPTVEVETVEANGRGGV
251 VLYRDGRASTFMTVAATHRGIHQVMWVFNPSKIAALLRSCSGSREAACSS
301 A

>ECFp10461 ECF41 ECF41s10 Herbiconiux solani NBRC 106740

1 MAQATEVFSAVRRRLFGIAYRMLGTVSEAEDIVQDVWLRWQTCDRSAVLD
51 PPAFLATATTRLAINVLQSARSRRETYIGPWLPEPVNTDDDPALGAERGE
101 ALGFAMLLLLEKLTPTERAAYVLREAFDYPYPQIAQIVQLKEPATRQLVS
151 RARKHLAGEKRIAVESAEQRRLLTAFLQAAQQGDVTALEALFASDVVSYS
201 DGNGVKLAARIPILGRHRVAQFIAAFSSHFWQGKTIEWVELNGQPAVALA
251 EDGVVTTALTLTPGDEGIRQVMWMMSPAKLTRVTAASA

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more