ECF proteins of ECF subgroup ECF41s10

Displaying ECF 41 - 60 of 392 in total

>ECFp171962 ECF41 ECF41s10 Nocardiopsis flavescens

1 MPTEERGPAADAPGTDLERAEEVFRGVRGRLFGIAYRILGSAAEAEDVLQ
51 EAWIRWQTYDRAAVREPGAFLATTVTRLAINVAGSARARHESYAGPWLPE
101 PVDTSADPALGAERGAALEVAVLMLLERLTPTERAAYVLREAFDYPYDRI
151 SEIIGQSAANTRQLVSRARRHVSRERRAGVGEAEQRRLLTAFVDAARGGD
201 LSALEELLAHDAVSYSDGGGAVRASRFPVVGRARVARYVRAFADRFWAGV
251 EVEQVRANGAAAVRLTREGGVVAVVTVAASAEGVDRVLWMMNPAKLGGFA
301 AAPGA

Name Aliases LCA Taxa Group Subgroup
ECFp173053
Asanoa ishikariensis ECF41 ECF41s10

>ECFp173053 ECF41 ECF41s10 Asanoa ishikariensis

1 MMGLVQDATLGDALAAFAVVRPRLFGIAYRMLGSVADAEDVVHDAWLRWQ
51 QTDRAAVRDPEGFLITTTARLAVNAATSARARREVYSGPWLPEPVDTSTD
101 PVARAERDESVELAVLLLLERLSPAERAVYVLREAFDYPFRRIGEVLDTS
151 EANARQLARRARTHLDQERHDPVPRADHVRLLRSFLAAARAGDLHQLEDL
201 LADSAVSYADGGGTVRAAPMPIVGRENVARYIVGLMAKFGRDLELEIVEA
251 NGGPAVLASRDGAAVALFTLDASAAGIEQIQIVLNPTKLGQFKPTVHGKS
301 DQT

Name Aliases LCA Taxa Group Subgroup
ECFp173222
Agromyces flavus ECF41 ECF41s10

>ECFp173222 ECF41 ECF41s10 Agromyces flavus

1 MEGTIEAALDTFRAVRPRLFGIAYRMLGSASEAEDIVQDAWLRWQGTDRT
51 AVLDPPAFLATVTTRLSINALQSARARRETYIGPWLPEPVDTSNDPTLGA
101 ERAEALGFAVLVMLERLTPTERAAYVLREAFAYDYSQICEIVQVSEAAAR
151 QLVSRARKHLAGERRREVTRHEQHRLLTAFLAAAKTGDLEALEQLFTEDV
201 VSYSDGGGVVRASKFPVVGRVRVARFVRAFHTHFWEGVDIEEADVNGQPS
251 VILSKAGSTFAVVIVVASGDAIDQVLWMMNPHKLAAVALRAAA

Name Aliases LCA Taxa Group Subgroup
ECFp173425
Terriglobus roseus ECF41 ECF41s10

>ECFp173425 ECF41 ECF41s10 Terriglobus roseus

1 MPAVMEEELIPNVHERGGHDDGLSSFAAVRPRLFGIAYRMLGSAAESEDI
51 LQDVWMRWQLTNRSVVENPAAFLATTTTRLCINLIQSASSRHETYTGTWL
101 PEPVDTSSDPTLGAEREEALQLAVLVLLEKLPATERAAYVLREAFDYSYR
151 EIAETLQIEEANARQLASRARKHLAEERRTAVDAAEQRRFLEAFINAAQR
201 GDMATLENLFAEDVVSYSDGGGFVRAARVPVAGRERVAKFIAAFASHFWL
251 GVTLSWTHVNGKESILISRGNEPIGLVATDASDQGIHQIMWVMRPSKLSR
301 MQTS

>ECFp173461 ECF41 ECF41s10 Streptomyces sp. 3213.3

1 MHVEPSPTRTDDLDEAVAVFVCHRRPLFGIAYRILGSAVEAEDVVQEVWL
51 RWQKADRPAVVSPVAFLSTATTRLAINVAQSARVRRETYIGPWLPEPVDT
101 SADPALGAERAEAVELALLLVLERLTPVERAAYVLREAFDYGYAEIAQML
151 ELGVVNVRKIVSRARRHVLDERRESVDAAEHRRLLSAFVAAARTGDVASL
201 EALLTPDAVSLSDGNGIRGCARVPVLGRARVARLSVHRRFWREAEPEFVE
251 ANGSTGVVVRRDGRPLAFLTAAASKDGIHQLLWVFAPGKLAAVTGSRPGG
301 WRRRWAAGSRAAVCRG

>ECFp173466 ECF41 ECF41s10 Saccharothrix sp. ALI-22-I

1 MTPEPEDTDDLEQAAAIFTNVRPRLFGIAYRMLGSATEAEDLVQDVWLRW
51 QTCDRAQVVNPDAFLATTMTRLAINALQSARVRRETYVGPWLPEPVDTSA
101 DPYLGAERGEALEFAALMLMEKLTPNERAAYVLREAFDYAYAQIADILRS
151 TEPAVRQLVSRARKHMTGERRTPATAAAQRELLTRFIAAARTGDMAALER
201 LFAADVTSLSDGNGRMRVARRPVVGVPAVAQFMDAISTWFWDDLDVRWVS
251 ANGQTSAVLRRNGAEFGVLTVSATTEGIDQVLWLLNPEKITAVSTAFQSP
301 MSKIAVVPGRGRRLRKG

>ECFp173480 ECF41 ECF41s10 Streptomyces sp. CB01883

1 MDERQPLTDDSLRAAAEAFERLRPRLFGIAYRVLGSVSEAEDVVQDVWVR
51 WQGTDRGAVLDPGAYLAKAATRLAVNVARSARVRREAYVGPWLPEPVDTS
101 VDPQVGAERGEALELAVLLVLQRLNPVERAAYVLREAFAYAYDEIAGILE
151 LSQANTRQIVSRARKRLAAERRAPVDSAQHRRLLDAFVAAARHGDVAALE
201 DVLSADVVAYADGNGMRGVARLRVGGASRVARVSAFARKFFPRAVYGVVE
251 ANGRPAVLLVQDGAAVALVSVTVGPDGIDGLYWVLAPDKLRAYEWSAHRL
301 TGQP

>ECFp173501 ECF41 ECF41s10 Kibdelosporangium sp. MJ126-NF4

1 MEPVATDHAVEVFTELRPRLFGIAYRMLGSALDADDLLQEVWLRWQDYDH
51 AKVANPAAFLATVTTRLAINATRTARARHETYIGPWLPEPVDTSADPQLG
101 AERDAALELAVLLLLEKLPATERAAYVLREAFDYPYAQIAEIVQVSEVAA
151 RQLVSRARKHLAAERRTPTTAQDQRRLLTAFVAAAKSGDLATLEELLAAD
201 VVSYSDGGGVQRASKIPVLGRERVSKYVRAFADRFWVGVDITWVQVNGQT
251 AALLTHSGERYGMVTVTASANGIDQVLWLLNPHKLAAIAR

Name Aliases LCA Taxa Group Subgroup
ECFp173504
Microbispora rosea ECF41 ECF41s10

>ECFp173504 ECF41 ECF41s10 Microbispora rosea

1 MRDIGAESRRSGTEDLDQAAATFESVRPRLFGIAYRILSSATEAEDLLQD
51 VWLRWQAYDRGTVTDPGAFLATVTTRLAINTLQSARVRRETYVGPWLPEP
101 VDTSNDPHLGAERGEALGFAVLLLLEKLSPTERAAYVLREAFDYPYRRIA
151 EIIEASEAAVRQLVSRARKRIGSERRAPVTRAEQRRLLTAFVAAARAGDL
201 AALEELLASDVISYSDGGGAVRASRIPVVGAFRVAKYIRAFADRFWAGVE
251 VEWADVNGQAAALLRHDGELLAVVTVDASDEGIDQVLWLMNPAKIGALSA
301 AS

Name Aliases LCA Taxa Group Subgroup
ECFp173548
Amycolatopsis lurida ECF41 ECF41s10

>ECFp173548 ECF41 ECF41s10 Amycolatopsis lurida

1 MGLGVADSGVGTELGGADDLETATAVFTQVRPRLFGIVYRMLSSVTEAED
51 LVQEVWLRWQTYDRSTVVNPEAFLATITTRLAINVLQSARKRRETYIGPW
101 LPEPVDTGADPYLGAERGEALEFAALLLMEKLTPNERAAYVLREAFDYSY
151 TQIADILSATEPAVRQLVSRARKHIAGERRTPVTAAEQRELLTTFLAAAR
201 SGDLTALERLFTPDVTSLSDGNGRKGIARTPLVGAARVAKFLQAISTWFW
251 DGVEVRWAITNGQTSAVLCQDGAVYGLLTVSASTEGIDQLLWLVNPEKNG
301 AVSIVG

Name Aliases LCA Taxa Group Subgroup
ECFp17359
  • RNA polymerase subunit sigma-24
  • ECF-family RNA polymerase sigma factor
  • ... more
Mycolicibacterium brisbanense ECF41 ECF41s10

>ECFp17359 ECF41 ECF41s10 Mycolicibacterium brisbanense

1 MTDLADAEEVFTEVRPRLFGLAYRMLGSVAEAEDVLQDAWVRWQATDRDD
51 VREPAAFLITMVTRMCVNVLQSARVRRETYIGPWLPDPVDTSADPALGAE
101 RGEALQVATLMLMEKLAPPERAAYILREAFDYPYELIGETIAVSDVNARQ
151 LVSRARRHLAARRGEPASTEAQRRLLTAFVAAAQTGDMSDLEELLASDVA
201 SYTDGNGMRNAAPVPVVGRERVSKFVLAFRRRFWRNSTVTWITANGQGGA
251 LISQDGRLAAFLTVTVSAEGIEELLWVLSPDKLAHIATAVPDPAETV

Name Aliases LCA Taxa Group Subgroup
ECFp17389
  • RNA polymerase subunit sigma-24
  • ASE16_00870
  • ... more
Leifsonia sp. Root227 ECF41 ECF41s10

>ECFp17389 ECF41 ECF41s10 Leifsonia sp. Root227

1 MRDEPTAGAELDEAADTFLQVRPRLFGIAYRVLGSASDAEDVVQEAWLRW
51 QRYDRSTVDDPRAFLATTTTRLAINVAQSARARRETYIGPWLPEPVDTSA
101 DPTLGAERDEALGFAVMLLMEKLTPTERAAYVLREAFDYPFSQIAEIIQT
151 SEANTRQLASRARKHLAAERQAKPVDPAEQRRLLDTFLAAAQTGDLTELE
201 SMFAADVVSYADGGGIVRASRIPVRGRETVAKYIRAFAPRFWVGVSLRPV
251 ETNGEPAVALVRDGAIFAVVALSSSAEGIDRLLWMMNPQKLARVASVSA

>ECFp17744 ECF41 ECF41s10 Promicromonospora kroppenstedtii DSM 19349

1 MTGDVDTTLDDAAEVFATARKRLFGIAYRMLGSAAEAEDVVQETWVRWQT
51 TDRSVVLNPQAFLTTAATRLAINVLQSARSRRETYIGPWLPEPVDTSDDP
101 TLGAERAEALDVAVLVLLEKLTPTERAAYVLREAFDYGYPEIAQIVGVSP
151 TATRQLVSRARKHLASERRNEVSTTARQDLLAAFLAAARAGDVARLERLF
201 AEDVVTRADSNGRAKHVARVVVQGRNKVARVLSSFAETFWAGITTRPVEV
251 NGAEGFAMERDGELVGVLSVVVSDQGVHELMWQMNPEKTEPLRRAWANQA
301 APEAGVGEATPEPPATARS

>ECFp17757 ECF41 ECF41s10 Streptomyces

1 MDVRDASESLDRATEDFLAARPQLFGIAYRVLGSAAEAEDVLQETWVRWQ
51 NTDRSGVREPAAFLTTITARLAINVAQSARVRRESYVGPWLPEPVDTRHD
101 PQLGAERAEALEMAVLLLLEKLNPVERAAYVLREAFDYPYKQVAEILETS
151 EPNTRQLVSRARKHLSAERKEPVSPADHRRLLEVFLAAAQTGDMRVLENV
201 LAADVVSYADGGGIRGASRIPVVGRLRVSKYLAAFAPRFWPPAETRWVEA
251 NGGPAVLVTAGGNPVALLSVDASEDGIHRVMWVMNPEKLSPYVTSLTA

>ECFp17819 ECF41 ECF41s10 Cellulomonas sp. Root137

1 MSAFEDVRPRLFGIAYRMLGSVAEAEDVVQDAWLRWQGTDRRGVRNPAAF
51 LTTTTTRLAINATTSAHARRETYIGPWLPEPVDTSADPALGAERAEALET
101 AVLLLLEKLGPTERAAYVLREAFGYSYREIADVLDVSEGNARQIARRARE
151 HLESERSAPASPAQQRRLLESFVAAARVGDLDGLERLLVDDVVVRPDGGG
201 EVHASRVELVGAARTVTFLDNILRKYWQDSTLRIVEANGGTALLVTAADG
251 SPQAILTLDGSARGIERVFIQVSPSKMQRFAPAA

Name Aliases LCA Taxa Group Subgroup
ECFp1788
Frankia sp. EAN1pec ECF41 ECF41s10

>ECFp1788 ECF41 ECF41s10 Frankia sp. EAN1pec

1 MGDLDEAAAIFMGVRPRLFGIAYRMLGSASEAEDLVQDVWLRWQATDRSV
51 VKSPGAFLATTTTRLAINELQSARVRRETYIGPWLPEPVDTSADPFLGAE
101 RGEALELAVLMLMEKLTPQERAAYVLRQAFDYPYPQIAGILQSTEPAVRQ
151 LVSRARKHVTGERKIPVLETAQRQLLATFLEAARAGDLEALEKLFAADVA
201 SISDGNGARQVSRKVVSGAARVAKYIAAFSTWFWDGVELQWVTTNGQTSA
251 IMRRGDTLLGMVTIVASEAGIEQLLWMLNLEKVAAVADVTE

>ECFp18643 ECF41 ECF41s10 Streptomyces sp. LUP47B

1 MYVEPSLTTPDDLEDAVAVFVHHRKRLFGIAYRILGSTVEAEDVVQEVWL
51 RWQKTDRSVVLSPAAFLSSATTRLAINVAQSARVRRETYIGPWLPEPVDT
101 GADPEVGAERAEAVEMALLLMLEKLTPVERAAYVLREAFDYAYAEIADML
151 EVSLVNVRKIVSRARRHLLEERRETVDAAEHRRLLSAFVSAARTGDVASL
201 EALLTPDVVSLSDGNGMRGCARVPVRGRARVARLAVYRQLWREAVPELVD
251 ANGATGVLLHRDGRAVAFMTAAASKHGIHQVLWVFAPSKIAAFLASRSRF
301 TMSPGAVPDSV

Name Aliases LCA Taxa Group Subgroup
ECFp1907
  • MSMEG_1692
  • ECF-family protein RNA polymerase sigma factor
Mycolicibacterium smegmatis ECF41 ECF41s10

>ECFp1907 ECF41 ECF41s10 Mycolicibacterium smegmatis

1 MDPAPSSASDPAWTELSEAEAVFTRVRPRLFGVAYRMTGTVAEAEDAVQE
51 AWLRWQDTDRAAVTDPVPFLMTVVTRICLNVLQSARARHETYIGPWLPEP
101 VDTTADPALGAERGAALELATLMLLERLAPPERAAYILREAFDYPYEQIA
151 ETVGVSVPNARQLVSRARRRVTTRRAAPVATAEQDRLLRAFVTAARSGDL
201 DALEEILAEDVVSHTDGNGARNAAQIPVVGRTTVAKFVRAFRNRLWPGAS
251 LRWITANGHSAVLVVHDDSPAAFLTVAASADGIHRLLWVLAPEKLAGIAQ
301 AQGR

Name Aliases LCA Taxa Group Subgroup
ECFp1972
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • Ndas_0994
Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111 ECF41 ECF41s10

>ECFp1972 ECF41 ECF41s10 Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

1 MQSAVPREPGPLEEAAQAFTGVRPRLFGIAYRMLGSWAEAEDLVQEVWLR
51 WQRTDHGVVEDPAAFLATITTRLAINVLKSARARREAYVGPWLPEPVDTG
101 ADPGVGAERGAAVELALLLLMEKLTPTERAAYVLREAFDYPYDRIAAVVR
151 TGEANARKLVSRARGHLSEGRREPVNPREHRRLVEAFLTAAQAGDLAALE
201 EILAEDVVSRSDGGGRVRNSARVPVTGRDRVARLLQAFAPRFWPGSRTEI
251 AEMNTRPGLVVSRGGTPFALLSVDASAQGIHQLLWVMNPGKIASFQRSSR
301 GVIGAPGSPPGAGGLSDAGEPAC

>ECFp19765 ECF41 ECF41s10 Microbacterium sp. 292MF

1 MGTEQAETQTSVPDGLENAVAVFDEHRRRIFGIGYRMLGTVADAEDIVQE
51 TWIRWQNADRDGIHDPAAFLATIATRLAINATQSARARRETYIGPWLPEP
101 VNTDADPALGAERGEALQFAILLMLEKLTPTERAAYILREALDYPYERIA
151 EIISTSVASARQLVSRGRKHLASARRAEVAAAEQRRLLEAFLVAAQKGDV
201 GDLERLFATDVVSYTDGNGAALAARIPVIGRSRVAKFVAAFSSHFWTGKS
251 IGWIEVNGQPAAALALDGVVTTIVTVTAGADGIHQLLWVMSPGKLAHARV
301 GA

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more