ECF proteins of ECF subgroup ECF41s10

Displaying ECF 381 - 392 of 392 in total

>ECFp18834 ECF41 ECF41s10 Streptomyces achromogenes subsp. achromogenes

1 MRAGGPPGTLDQATKDFLSARPQLFGIAYRVLGSAVEAEDVLQETWVRWQ
51 NTDRAKVREPAAFLTTVATRLAINLAQSARVRRESYVGPWLPEPVDTTQD
101 PQLGAERAEALEMAVLLLLEKLNPVERTAYVLREAFDYPYARVAEILETT
151 EANARQLVSRGRRHLAAERKETVSPAAHRRLLEVFLSAARTGDLSVLEDV
201 LTADVVSYSDGNGIRGASRIPVIGRPHVSRYLVAFAPRFWPQAETRWVEA
251 NGRSAVLVASGEQAVALLTADISTDGIDRLMWVMNPAKLAPYVASLSD

Name Aliases LCA Taxa Group Subgroup
ECFp18837
  • RNA polymerase subunit sigma-24
  • ADL34_21170
  • ... more
Streptomyces ECF41 ECF41s10

>ECFp18837 ECF41 ECF41s10 Streptomyces

1 MRAGAHPDTSDSGLDEFLSARPRLFGIAYRILGSAVEAEDIVQDAWLRWQ
51 NTDRAQIHEPAAFLTTVTTRLAINLAQSARVRRESYVGPWLPEPVDTTQD
101 PHLGAERAEAVELAVLLVMEKLNPTERAAYVLREAFDYPYRRVADILETS
151 EANARQLVSRARKHLGAERKERVSAAAHRRLLEGFLSAARTGDLSTLEEL
201 LTSDVVSYSDGGGIRGASRIPVIGRDHVSRYLAAFAPRFWPDAETRFVEA
251 NGRPAVLVARDDAPVALLCVDASEAGIERIMWVMNPVKLDPYVLSLGA

>ECFp18982 ECF41 ECF41s10 Streptomyces sp. NRRL WC-3626

1 MHTGDDTDSLDRATRDFIAARPQLFGIAYRVLGSSAEAEDVLQEAWLRWQ
51 NTDRGGVHEPTAFLTTITTRLAINVAQSARVRREAYVGPWLPEPVDTSQD
101 PQMGAERAEALEMAVLLLLEKLNPLERGAYVLREAFDYPYKQVAEILETS
151 EANTRQLVSRARKHLAAERKEPVSPAEHKRLLEVFLAAAQRGDMAVLENV
201 LAADVVSYADGGGIRGASRIPVVGIDHVSKYLAAFAPRFWPRSRTRWVEA
251 NGRPAVLVSVDGDPMALLSIDVSADGIDRIMWVMNPAKLSPYVASLSG

>ECFp19044 ECF41 ECF41s10 Streptomyces olivochromogenes

1 MQDEPSPRASDLDEAVSVFVQHRARLFGIAYRVLGSAAEAEDVVQEVWLR
51 WQRTERSVVVSPVAFLSSTATRLAINVAQSARVRRETYIGPWLPEPIDTS
101 SDPEVGAQRAEALELALLLVLEKLNPTERAAYVLREAFDYSYPEIAHMLQ
151 LSLVNVRKIVSRARRHLSDEQRESVDTVEHRRLLNAFVSAARTGDVASLE
201 ALLTPDAVSLSDGNGIRGVARVPLLGRARVANLATAYPRFWGNVGVEFVA
251 ANGRMGAMIHREGEPSTFMTIAAEREGIYKVMWVFNPGKIAAFLSSRSRS
301 TTPLRPAPGGV

Name Aliases LCA Taxa Group Subgroup
ECFp1929
  • ECF family RNA polymerase sigma factor
  • SCO7112
  • ... more
Streptomyces ECF41 ECF41s10

>ECFp1929 ECF41 ECF41s10 Streptomyces

1 MHAGAPPGTLDQATKDFLSARPQLFGIAYRVLGSAAEAEDIVQETWLRWQ
51 STDRSKVHEPTAFLTTVATRLAINVAQSARVRRESYVGPWLPEPVDTTQD
101 PHLGAERAEALEMAVLLLLEKLNPVERTAYVLREAFDYPYGRIAEILETS
151 EANTRQLVSRGRKHLAAERKEAVTPTAHRRLLEVFLSAARTGDLSGLEDV
201 LTADVVSYTDGNGIRGASRIPVIGLPHVSRYLVAFAPRFWPQSQVRWVEA
251 NGRPAVLVLSGEEAVALLTADISADGIDRLMWVMNPAKLAPYVASLRD

>ECFp19828 ECF41 ECF41s10 Streptomyces sp. NBRC 110028

1 MHAGAHPDNLGQATKEFISARPQLFGIAYRVLGGSAAEAEDIVQETWLRW
51 QNTDRAKVHEPTAFLTTIATRLAINLAQSARVRRESYVGPWLPEPVDTSH
101 DPQLGAERAEALEMAVLLLLEKLNPVERTAYVLREAFDYPYGRIAEILET
151 TEANARQLVSRGRKHLAAERKERVTPAAHRRLLEVFLSAARTGDLSVLED
201 VLTADVVSYTDGGGIRGASRIPVVGRAHVSRYLVAFAPRFWPQADIRWVE
251 TNGLPAVLVSSGGAAVALMSVDISAEGIERIMWVMNPAKLSPYVASLSS

>ECFp19929 ECF41 ECF41s10 Streptomyces

1 MHAGTPPGTLDQATEDFLSARPQLFGIAYRILGSAAEAEDIVQETWLRWQ
51 GTDRSKVHQPTAFLTTVATRLAINVARSARVRRESYVGPWLPEPVDTTRD
101 PHLGAERAEALEMAVLLLLEKLNPVERAAYVLREAFDYPYGRISEILETS
151 EANTRQLVSRGRKHLAAERKEAVAPTAHRRLLEVFLSAARTGDLSVLEDV
201 LTADVVSYTDGNGMRGASRIPVVGLPHVSQYLVAFAPRFWPRSQVRWVEA
251 NGRPAVLVLSGEEAVALLTADISADGIDRLMWVMNPAKLAPYVASLRD

>ECFp19949 ECF41 ECF41s10 Streptomyces sp. NRRL B-24720

1 MRAGDDADSLDRATREFIAARPRLFGIAYRVLGSAVEAEDIVQEAWLRWQ
51 NANRADIQEPAAFLATVTVRLAINFAQSARVRRESYIGPWLPEPVDTSMD
101 PQVGAERAEALDMAVLFILEKLGPAERAAYVLREAFDYPYKQIADILETS
151 EANSRQLVSRARKHLSAEHREPVSPAAHRRLLEVFLAAAQTGSLSALEQV
201 LAEDVVSYSDGGGVRGASKIPVVGRPHVSKYLAAFAPRFWPPTDVRWVEA
251 NGRPAVLVSAGGNAVALLTVDVSARGIERIMWVMNPAKLAPYVASLAN

Name Aliases LCA Taxa Group Subgroup
ECFp11848
  • putative RNA polymerase ECF-type sigma factor
  • RNA polymerase sigma24 factor
  • ... more
Gordonia effusa NBRC 100432 ECF41 ECF41s10

>ECFp11848 ECF41 ECF41s10 Gordonia effusa NBRC 100432

1 MNRESDLADAVAVFDESRPRLFGIAYRMLGSVVEAEDIVSEAWLRWQQTD
51 RGGIRNPPAYLTTVTTRLAINTLDSARFTRESYLGPWLPEPVDTSADPTL
101 GAETAEALDHAVLVLLESLPSDQRAAYVLREAFAYDHEQIADVLSTTAAN
151 SRQLVSRARKHVGAQRKMPVDPAEHRSLLDAFVAAAQDGDLRRLEEVLAG
201 DVVSISDGAGIAPRAARRPVIGIDKVARMVAGFADWWIDTTVISVNTNGA
251 PSAVIRRGNQTLAVLTISASPSGIERLHWVMAPDKLTAL

Name Aliases LCA Taxa Group Subgroup
ECFp138593
Phycicoccus cremeus ECF41 ECF41s10

>ECFp138593 ECF41 ECF41s10 Phycicoccus cremeus

1 MTSREVDDAPGRTLDAAAEVFNDSRPRLFGVAYRMLGSVAEAEDIVQEAW
51 LRWQQTDRSLVGNPAGFLTTVTTRLALNVLDTARARREQYVGPWLPEPVD
101 TSADPTLGAETAEALDAAVLVLMEKLGPEHRAAYVLREAFCYPYDEIAEI
151 LDTTAPNARQLVSRAKKHVQSSRSEPVDPAEHRALLDAFVAAARDGDLAR
201 LEQVLSAEVVSTSDGAGIAPRAARRPVVGRDKVARFVAGWADWWTGTSLT
251 WLETNGRPSVLVTRGDSALALLTISSSGSGIDQLLWVMAPAKLAPIAG

>ECFp172565 ECF41 ECF41s10 Cellulomonas sp. 73-145

1 MAADPALEEFEAHRARLFGIAYRMLGSAADADDVLQDAWLRWQAVDRSAV
51 QAPAAFLARTVTNLCLTALTSARARREVYVGPRLPEPVLTGPAGTDLGPL
101 DHAEQRDSVSFALLTVLERLSPPERAAYVLREAFAYSAAEVAELIGTSEA
151 NVRQLHARARRRVSGAGAGAAPREADPARLRELVETFLDASRGGDLAALE
201 ALLSEDVVARADGGGVVSAGRRPVEGREKVARYVTGVVDRFAAGLQRVLV
251 EVNGVPAAAFTDGTSLRAVLVVQTRDGRVSALDLVLNPDKLAHAERQLSR
301 IGALPGREG

>ECFp138514 ECF41 ECF41s10 Lentzea waywayandensis

1 MTQQLDEAESAFAAARPRLFGIAYRMTGSVADAEDLVQEVWVRWQLADRA
51 AVLNPEAYLATAITRLAINESQTARARRETYVGPWLPEPVDTSADPQVGA
101 EQGAVLELAVLMLLEKLTPTERAAYVLREAFDYPYREIAEIVQTSEVATR
151 QLVSRARKHLADERRVPVERADQRKLLEAFVAAAQAGDLAALEKLFAQDV
201 VSWSDSNGSIRAAGRPLFGAASLAKIISGWAPSFWAGAEASFVEANGLTA
251 IRLRKDSGTYAVITVTASDEGIDQVLWLVNPEKLAAFQ

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more