ECF proteins of ECF subgroup ECF41s10

Displaying ECF 21 - 40 of 392 in total

>ECFp17964 ECF41 ECF41s10 Streptomyces corchorusii

1 MHAGAHPDTLDQATKDFLAARPRLFGIAYRVLGSAAEAEDVVQETWLRWQ
51 NTDRTKVLEPAAFLTTVATRLAINLAQSARVRRESYVGPWLPEPVDTTED
101 PQLGAERAEALEMAVLLLLEKLNPVERTAYVLREAFDYPYGRVSEILETS
151 EANARQLVSRARRHLAAERRERVTPAAHRRLLEVFLSAARTGDLSVLEDV
201 LTADVVSYSDGGGIRGASKIPVIGRPHVSRYLVAFAPRFWPQADVRWVEA
251 NGLPAVLVSSGGQAVALLSVDISTEGIDRLMWVMNPAKLAPYVASLHD

>ECFp17722 ECF41 ECF41s10 Amycolatopsis balhimycina FH 1894

1 MGMSDVNVVSATVDAAEDFQSVRPRLFGIAYRVLGRAADAEDVVQEVWIR
51 WQGTDRARVHDRVAYLVKVTTNVALNVAVSARFRREIAVGDQLPERIPGT
101 EDPTQASERLEDLQYAVQLLVQWLSPAERAVFVLREAFGYRFGEIAETLA
151 ISNANARQLARRARAHLAGRRSEPVQAVECDRLVRVFLDAAQDGAVARLE
201 HVLRDDVITGSARSPLAAAG

Name Aliases LCA Taxa Group Subgroup
ECFp17483
  • RNA polymerase sigma24 factor
  • A3IC_RS0121375
Streptomyces scabrisporus DSM 41855 ECF41 ECF41s10

>ECFp17483 ECF41 ECF41s10 Streptomyces scabrisporus DSM 41855

1 MNAGADTDSLDQAARDFLAARPRLFGVAYRVLGSAVEAEDIVQEAWLRWQ
51 NADRARILEPAAFLTTVTARLAINLAQSARVRRESYVGPWLPEPVDTSAD
101 PQMGAERAEALELAVLFLLEKLNPMERAAYVLREAFDYPYAQIARILETS
151 EANTRQLVSRGRKHLAAERRERVGTTDHRRLLEVFLAAAQQGDLAALENV
201 LAADVVSYTDGGGLRGASKIPVVGRLHVSKYLVAFAPRFWPGSEVRWVEA
251 NGRPAVVVSSGGEAVALLSVDVSAEGIDRILWVMNAAKLSPYMTSPSS

>ECFp17437 ECF41 ECF41s10 Streptomyces fulvoviolaceus

1 MVLEPSPTTSDLEEAVSVFVQYRNRLFGIAYRVLGSAVEAEDVVQEVWVR
51 WQNTDRSVVVSPVAFLSSTTTRLAINVAQSARVRRETYIGPWLPEPVDTS
101 SDPEMGAQRAEALELALLLVLEKLSPTERAAYVLREAFDYAYPEIAEILR
151 LSLVNVRKIVSRARKHLSEEQRESVDTAEHRRLLSAFVAAAQTGDVASLE
201 ALLTPDTVSLSDGNGMRGCARIPVLGRARVAKMVTYPKLWREAEPRLVDA
251 NGSTGVMVYRGGQPIAFMTMAASREGIHQLMWVFSPIKIAAFLGSRSRFA
301 TAGGPASGGV

Name Aliases LCA Taxa Group Subgroup
ECFp17413
  • RNA polymerase sigma24 factor
  • OP79_RS28670
Streptomyces yerevanensis ECF41 ECF41s10

>ECFp17413 ECF41 ECF41s10 Streptomyces yerevanensis

1 MHAGSHPDALDQAMEDFLAARPQLFGIAYRVLGSMVEAEDVVQDTWVRWQ
51 NTDRTKVKEPAAFLTTVVTRLAINLAQSARVRRESYVGPWLPDPVDTTED
101 PQLGAERAEALELAVLMLLEKLNPVERTAYVLREAFDYPYGRIAEILETT
151 EANARQLVSRGRKHLAAERTARVTRTAHRRLLEVFLSAARTGELSVLEDI
201 LTADVVSYSDGGGTRGASRIPVVGRTHVSRYLVAFAPRFWPQTDIRWVEA
251 NGLPAVLISSGGEPVSLLSLDVSEEGIDRVMWVMNPAKLAPYVASLQD

>ECFp173551 ECF41 ECF41s10 Streptomyces sp. Ag109_O5-10

1 MRAGDHADPLDRATKEFVAARPQLFGIAYRVIGSAVEAEDIVQEAWVRWQ
51 NTDRSDVHEPAAFLATVTTRLAINFTQSARVRRESYIGPWLPEPVDTRQD
101 PQLGAERAEALDLAVLFLLEKLNPVERAAYVLREAFDYTYRRIADIVETS
151 EANARQLVSRARKRLAAERREPVGSTEHRRFLEVFLAAAQNGDLSVLEEV
201 LTEDVVSYADGGGMRGASKIPVSGLPHVSRYLVAFAPRFWPQAQVRWVEA
251 NGRPAVLVSASGTAVALLSADVSARGIERLLWVMNPAKLAPFVASLGA

>ECFp173489 ECF41 ECF41s10 Streptomyces sp. CB02400

1 MHAGAPRDPLAQATRDFVSARPRLFGVAYRILGSAAEAEDVVQETWLRWQ
51 STDRTKVQEPTAFLATVTTRLAINLAQSARVRRETYVGPWLPEPVDTRQD
101 PQLGAERAEALETAVLLLLEKLNPVERAAYVLREAFDYPYGLVAGMLETS
151 EANARQLVSRARKHLATERRERVSPAAHRRLLEVFLSAAQTGDLSTLEEV
201 LTADVVSYTDGGGIRGASRIPVVGRTHVTRYLAAFAPRFWPSTDVRWVEA
251 NGRPAVLVSSEGNAVTLLSVDVSTEGIDRIMWVMNPEKLSPYVAALGT

>ECFp17341 ECF41 ECF41s10 Herbidospora daliensis

1 MISVDSLENAASVFTELRPRLFGIAYRMLGSAAEAEDVVQDVWLRWQGAD
51 RTAVQSAPAFLATIATRLSINVARSARVRRESYIGPWLPEPVDTSADPTL
101 GAERGEALEFAFLLLLERLSPTERAAYVLREAFVYPYEQIAEIIQVSAAN
151 ARQLVSRARKHLAAGRHEPIDKTEHRRLLETFLDAAQTGDVVALEHLFAE
201 DVVSVTDGNGVRGAARLVMHGVPRVTKFITAFAPRFWPGATVTFVEANGA
251 PAVFVPAREKIGGALLVLDASPDGIHQLLWLMNPDKLAGYAT

>ECFp172969 ECF41 ECF41s10 Streptomyces sp. PAN_FS17

1 MRAEDGTDSLDRAAQQFMAARPQLFGIAYRILGTAAEAEDVVQDAWLRWQ
51 KTDRTEIKEPAAFLATVTARLAINVAQSARMRRESYTGPWLPEPVDTKAD
101 PQLGAERAEALDMAVLLLLEKLNPVERAAYVLREAFDYPYKRIAEILETN
151 EAHTRQLVTRARKHMAAERKEPVSSTAHRRLLEVFLDAARTGSLSGLENV
201 LAEDVVSYADGGGIRGASKIPVVGRLHVSKYLAAFAPRFWPPAEVRWVEA
251 NGRPAVLVSAEGNPVALLCVDVSERGIERIMWVMNPAKLAPYVASLTD

>ECFp172964 ECF41 ECF41s10 Kribbella sp. ALI-6-A

1 MTVTVSRAHTESPIRVPSPAADDGVAVFVSARPRLLRIAGRVLASAGDAE
51 DVVQDIWLRWQRTDRTVVADPHAFLVTMTVRLAINVSQSARRRHETPVGE
101 WYQEQLGCTDDDPAAEAELGEEVELAILTLLGTLPPRERAAYVLREAFDY
151 PYGRISEMLHTGAANARQLVSRARGHLTADRRAPVSSLAHRQLLDAFLKA
201 ARAGDLTDLEDLLTADLGGR

>ECFp172873 ECF41 ECF41s10 Streptomyces sp. cf386

1 MRAEDDADSLDEATRQFMAARPQLFGIAYRVLGSAVEAEDIVQEAWLRWQ
51 GTDRTEIREPTAFLATVTTRLAINLAQSARMRRESYVGPWLPEPVDTRAD
101 PQLGAERAEALDMAVLLLLEKLNPVERAAYVLREAFDYPYKRIADMLETS
151 EANTRQLVTRARKHLAAERTAPVSSTAHRRLLEVFLDAARTGSLSELEQI
201 LTADVVSYSDGGGIRGASKIPVVGRLRVSKYLAAFAPRFWPPTEVRWVEA
251 NGRPAALVSVDGNAVALLCADVSERGIEQIMWVMNPAKLAPYVASLTD

>ECFp172832 ECF41 ECF41s10 Mycobacterium sp. ST-F2

1 MVAGDDSSTDLEQATAEFIAVRGRLFGIAYRMLGSSSEAEDIVQEAWLRW
51 QTADRSAVVDPAAFLATTTTRLCLNALQSARARRETYVGPWLPEPVDTSA
101 DPHLGAERGEALELATVMLMEKLQPTERAAYVLREAFDYPYARIAEIVQV
151 KEANARQLVSRARKHISTSRREKTSPAEQKRLLEALVAAAQEGDVDALEQ
201 LFADDVVSYTDGNGMRGASRIPVVGRSAVAHFLKAFAPRWWQDTKLTWIE
251 ANAQPSVLVRRGAGIVAYLAISTSQRGIDQLLWVLSPAKLHGISKLLPAS
301 GDVS

>ECFp172742 ECF41 ECF41s10 Streptomyces sp. Ag109_O5-10

1 MRAGAHPDTFDRGLDDFLSARPRLFGIAYRILGSAVEAEDVVQDAWLRWQ
51 NTDRAQIHEPAAFLTTVTTRLAINLAQSARVRRESYVGPWLPEPVDTTQD
101 PHLGAERAEAVELAVLLLMEKLNPVERAAYVLREAFDYPYQRVADILETN
151 DANARQLVSRARKHLGAERKERVSPAAHRRLLEGFLSAARTGDLATLEDL
201 LTSDVVSYADGGGIRGASRIPVIGRDHVSRYLAAFAPRFWPDAETRFVEA
251 NGRPAVLVARDKAPVALLCVDASEAGIERIMWVMNPVKLNPYVLSLGA

>ECFp172729 ECF41 ECF41s10 Streptomyces melanosporofaciens

1 MDLEPRPPAGDLEEAVSVFVRHRGRLFGIAYRVLGSVVEAEDVVQEVWLR
51 WQKTDRSAVVSPVAFLSSTTTRLAINVAQSARVRRETYIGPWLPEPIDTS
101 ADPEVGAQRAEALELALLLVLEKLSPVERAAYVLREAFDYGYPEIADMLH
151 ISPVYVRKIVSRARKHLSDEQRESVDTAEHRRLLNAFVSAARTGDVASLE
201 ALLAPDATSLSDGNGLRACARIPVLGPARIAKLATYPRLWRDAEPRLVEA
251 NGLTGAVCYRDGEPATFLTVAASKVGIHKVMWVFTPSKIASFLASRSRCA
301 TASGRPDGTATTRPRRPTSHGHGCHTSPGCPVMSA

>ECFp172671 ECF41 ECF41s10 Streptomyces sp. Ag109_O5-10

1 MYLESSPARSDLDEAVSAFVQYRARLFGIAYRVLGSVAEAEDVVQEVWLR
51 WQKTDRSVVLSPVAFLSSATTRLAINVAQSARVRRETYIGPWLPEPVDTG
101 CDPEVGAQRAEALELALLLVLEKLSPTERAAYVLREAFDYSYPEIAEILQ
151 LSVVNVRQIVSRSRKRLAGEPRSSVDAQEHRRLLDAFVSAASTGDVASLE
201 AVLAPDVVSLSDGNGLRGAARVPVVGPARVANLATATRRFWQGADLRLVE
251 ANGRTGVMIYRDGSPTTILTIAASREGIRRVMWVFNPGKIAAFLDSGTRG
301 ATAPGLGAVVG

Name Aliases LCA Taxa Group Subgroup
ECFp15210
  • RNA polymerase sigma24 factor
  • G406_RS0135960
Pseudonocardia spinosispora DSM 44797 ECF41 ECF41s10

>ECFp15210 ECF41 ECF41s10 Pseudonocardia spinosispora DSM 44797

1 MPAQPELDAAASDFTRVRPKLFGIAYRVLGSVSDAEDIVQETWLRWQEYD
51 RAIVREPEAFLATIATRLSINVARSARARRETYPGPWLPEPVDTSADPGL
101 GAERAEALELAILQVMEKLTPSERGAYVLREAFDYPYSRIAEILEVTEAN
151 ARQLVSRARKDISAQRREPADPERQRRLLSAFLAAAQKGDLADLEELFAA
201 DVISYADGGGVVRGAAGYPIEGVERVAKVVAAYAPRFWTGVQLTWAETNG
251 RSSVLVSRDDSVVALITVGATAEGIDRLLWILNPAKIARMSVHL

>ECFp14691 ECF41 ECF41s10 Herbidospora yilanensis

1 MDSLENAASVFTELRPRLFGIAYRMLGSAAEAEDVVQDVWLRWQGADRSA
51 VQSPSAFLATIATRLSINVARSARARRESYIGPWLPEPIDTSADPTLGAE
101 RGEALEFAFLLLLERLSPTERAAYVLREAFVYPYEQIAEIIQVSAANARQ
151 LVSRARKHLAAGRHEPIDRTEHRRLLETFLDAAQSGDVVALEHLFAEDVV
201 SVTDGNGVRGAARLVMHGIPRVTKFVASFAPRFWPGATVTFVEVNGGPAV
251 FVPAREKTGGALLVLDASRDGIHQLLWIMNPDKLAGYAT

Name Aliases LCA Taxa Group Subgroup
ECFp14687
  • RNA polymerase subunit sigma-24
  • ADL34_24395
  • ... more
Streptomyces ECF41 ECF41s10

>ECFp14687 ECF41 ECF41s10 Streptomyces

1 MGDGDDREPLDRATADGDSLEHAMKDFVAARPQLFGIAYRMLGSVADAED
51 VLQETWLRWQRADRSAVREPAAFLTTVTTRLAVNSTQSARRRRETYVGPW
101 LPEPVDTRADPQLGAERAEAVDLAVLLLLERLNPQERAAHVLREAFDYPY
151 GRIAEILETSEPNTRQLVSRARKHLKAARREPVSEGAHRRLLETCLEAAR
201 TGTLSALEDLLAEDVVSYADGGGMRGASRVPVAGRERVARYLVAFAPRFW
251 PDAQVRWVEANGRPAVLVRRDDQPVALLCADVSDRGIERLMWVLNPAKLA
301 PYVAAVAG

Name Aliases LCA Taxa Group Subgroup
ECFp14500
  • RNA polymerase subunit sigma-24
  • AQI96_07670
  • ... more
Streptomyces canus ECF41 ECF41s10

>ECFp14500 ECF41 ECF41s10 Streptomyces canus

1 MDSLDEATKVFMAVRPQLFGIAYRVLGSSAEAEDVLQEAWLRWQHTDRGA
51 VREPKAFLATVTARLAINLAQSARVRRESYTGPWLPEPVDTRADPQLGAE
101 RAEALDLAVLFLLEKLNPVERAAYVLRQAFDYPYRQIADMLETSETNTRQ
151 LVSRAHKRISSERRKPVDPAEHRRLMEVFLAAAQTGDLAVLEDILTEDVV
201 SYTDGNGLRGATRIPVVGLEHVSRYLAAFAPRFWPNKEIDWVEANGGPAA
251 LVSAGGTPVALLILDISERGIERAMWVMNPEKLARYVASLDGDTTVSS

Name Aliases LCA Taxa Group Subgroup
ECFp14367
Streptomyces canus ECF41 ECF41s10

>ECFp14367 ECF41 ECF41s10 Streptomyces canus

1 MHAGAPPGTLDQATKDFLSARPQLFGIAYRVLGSAAEAEDIVQETWLRWQ
51 STDRSKVHEPAAFLTTVATRLAINVAQSARVRRESYVGPWLPEPVDTTQD
101 PHLGAERSEAVEMAVLLLLEKLNPVERTAYVLREAFDYPYGRIAEILETS
151 EANTRQLVSRGRKHLAAERKEAVTPTAHRRLLEVFLSAARTGDLSGLEDV
201 LTADVVSYTDGNGIRGASRIPVVGLPHVSRYLVAFAPRFWPQSQVRWVEA
251 NGRPAVLVLSGEKAVALLTADISADGIDRLMWVMNPAKLAPYVASLRD

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more