ECF proteins of ECF subgroup ECF41s10

Displaying ECF 361 - 380 of 392 in total

>ECFp172729 ECF41 ECF41s10 Streptomyces melanosporofaciens

1 MDLEPRPPAGDLEEAVSVFVRHRGRLFGIAYRVLGSVVEAEDVVQEVWLR
51 WQKTDRSAVVSPVAFLSSTTTRLAINVAQSARVRRETYIGPWLPEPIDTS
101 ADPEVGAQRAEALELALLLVLEKLSPVERAAYVLREAFDYGYPEIADMLH
151 ISPVYVRKIVSRARKHLSDEQRESVDTAEHRRLLNAFVSAARTGDVASLE
201 ALLAPDATSLSDGNGLRACARIPVLGPARIAKLATYPRLWRDAEPRLVEA
251 NGLTGAVCYRDGEPATFLTVAASKVGIHKVMWVFTPSKIASFLASRSRCA
301 TASGRPDGTATTRPRRPTSHGHGCHTSPGCPVMSA

>ECFp172742 ECF41 ECF41s10 Streptomyces sp. Ag109_O5-10

1 MRAGAHPDTFDRGLDDFLSARPRLFGIAYRILGSAVEAEDVVQDAWLRWQ
51 NTDRAQIHEPAAFLTTVTTRLAINLAQSARVRRESYVGPWLPEPVDTTQD
101 PHLGAERAEAVELAVLLLMEKLNPVERAAYVLREAFDYPYQRVADILETN
151 DANARQLVSRARKHLGAERKERVSPAAHRRLLEGFLSAARTGDLATLEDL
201 LTSDVVSYADGGGIRGASRIPVIGRDHVSRYLAAFAPRFWPDAETRFVEA
251 NGRPAVLVARDKAPVALLCVDASEAGIERIMWVMNPVKLNPYVLSLGA

>ECFp172832 ECF41 ECF41s10 Mycobacterium sp. ST-F2

1 MVAGDDSSTDLEQATAEFIAVRGRLFGIAYRMLGSSSEAEDIVQEAWLRW
51 QTADRSAVVDPAAFLATTTTRLCLNALQSARARRETYVGPWLPEPVDTSA
101 DPHLGAERGEALELATVMLMEKLQPTERAAYVLREAFDYPYARIAEIVQV
151 KEANARQLVSRARKHISTSRREKTSPAEQKRLLEALVAAAQEGDVDALEQ
201 LFADDVVSYTDGNGMRGASRIPVVGRSAVAHFLKAFAPRWWQDTKLTWIE
251 ANAQPSVLVRRGAGIVAYLAISTSQRGIDQLLWVLSPAKLHGISKLLPAS
301 GDVS

>ECFp172873 ECF41 ECF41s10 Streptomyces sp. cf386

1 MRAEDDADSLDEATRQFMAARPQLFGIAYRVLGSAVEAEDIVQEAWLRWQ
51 GTDRTEIREPTAFLATVTTRLAINLAQSARMRRESYVGPWLPEPVDTRAD
101 PQLGAERAEALDMAVLLLLEKLNPVERAAYVLREAFDYPYKRIADMLETS
151 EANTRQLVTRARKHLAAERTAPVSSTAHRRLLEVFLDAARTGSLSELEQI
201 LTADVVSYSDGGGIRGASKIPVVGRLRVSKYLAAFAPRFWPPTEVRWVEA
251 NGRPAALVSVDGNAVALLCADVSERGIEQIMWVMNPAKLAPYVASLTD

>ECFp172964 ECF41 ECF41s10 Kribbella sp. ALI-6-A

1 MTVTVSRAHTESPIRVPSPAADDGVAVFVSARPRLLRIAGRVLASAGDAE
51 DVVQDIWLRWQRTDRTVVADPHAFLVTMTVRLAINVSQSARRRHETPVGE
101 WYQEQLGCTDDDPAAEAELGEEVELAILTLLGTLPPRERAAYVLREAFDY
151 PYGRISEMLHTGAANARQLVSRARGHLTADRRAPVSSLAHRQLLDAFLKA
201 ARAGDLTDLEDLLTADLGGR

>ECFp172969 ECF41 ECF41s10 Streptomyces sp. PAN_FS17

1 MRAEDGTDSLDRAAQQFMAARPQLFGIAYRILGTAAEAEDVVQDAWLRWQ
51 KTDRTEIKEPAAFLATVTARLAINVAQSARMRRESYTGPWLPEPVDTKAD
101 PQLGAERAEALDMAVLLLLEKLNPVERAAYVLREAFDYPYKRIAEILETN
151 EAHTRQLVTRARKHMAAERKEPVSSTAHRRLLEVFLDAARTGSLSGLENV
201 LAEDVVSYADGGGIRGASKIPVVGRLHVSKYLAAFAPRFWPPAEVRWVEA
251 NGRPAVLVSAEGNPVALLCVDVSERGIERIMWVMNPAKLAPYVASLTD

>ECFp17341 ECF41 ECF41s10 Herbidospora daliensis

1 MISVDSLENAASVFTELRPRLFGIAYRMLGSAAEAEDVVQDVWLRWQGAD
51 RTAVQSAPAFLATIATRLSINVARSARVRRESYIGPWLPEPVDTSADPTL
101 GAERGEALEFAFLLLLERLSPTERAAYVLREAFVYPYEQIAEIIQVSAAN
151 ARQLVSRARKHLAAGRHEPIDKTEHRRLLETFLDAAQTGDVVALEHLFAE
201 DVVSVTDGNGVRGAARLVMHGVPRVTKFITAFAPRFWPGATVTFVEANGA
251 PAVFVPAREKIGGALLVLDASPDGIHQLLWLMNPDKLAGYAT

>ECFp173489 ECF41 ECF41s10 Streptomyces sp. CB02400

1 MHAGAPRDPLAQATRDFVSARPRLFGVAYRILGSAAEAEDVVQETWLRWQ
51 STDRTKVQEPTAFLATVTTRLAINLAQSARVRRETYVGPWLPEPVDTRQD
101 PQLGAERAEALETAVLLLLEKLNPVERAAYVLREAFDYPYGLVAGMLETS
151 EANARQLVSRARKHLATERRERVSPAAHRRLLEVFLSAAQTGDLSTLEEV
201 LTADVVSYTDGGGIRGASRIPVVGRTHVTRYLAAFAPRFWPSTDVRWVEA
251 NGRPAVLVSSEGNAVTLLSVDVSTEGIDRIMWVMNPEKLSPYVAALGT

>ECFp173551 ECF41 ECF41s10 Streptomyces sp. Ag109_O5-10

1 MRAGDHADPLDRATKEFVAARPQLFGIAYRVIGSAVEAEDIVQEAWVRWQ
51 NTDRSDVHEPAAFLATVTTRLAINFTQSARVRRESYIGPWLPEPVDTRQD
101 PQLGAERAEALDLAVLFLLEKLNPVERAAYVLREAFDYTYRRIADIVETS
151 EANARQLVSRARKRLAAERREPVGSTEHRRFLEVFLAAAQNGDLSVLEEV
201 LTEDVVSYADGGGMRGASKIPVSGLPHVSRYLVAFAPRFWPQAQVRWVEA
251 NGRPAVLVSASGTAVALLSADVSARGIERLLWVMNPAKLAPFVASLGA

Name Aliases LCA Taxa Group Subgroup
ECFp17413
  • RNA polymerase sigma24 factor
  • OP79_RS28670
Streptomyces yerevanensis ECF41 ECF41s10

>ECFp17413 ECF41 ECF41s10 Streptomyces yerevanensis

1 MHAGSHPDALDQAMEDFLAARPQLFGIAYRVLGSMVEAEDVVQDTWVRWQ
51 NTDRTKVKEPAAFLTTVVTRLAINLAQSARVRRESYVGPWLPDPVDTTED
101 PQLGAERAEALELAVLMLLEKLNPVERTAYVLREAFDYPYGRIAEILETT
151 EANARQLVSRGRKHLAAERTARVTRTAHRRLLEVFLSAARTGELSVLEDI
201 LTADVVSYSDGGGTRGASRIPVVGRTHVSRYLVAFAPRFWPQTDIRWVEA
251 NGLPAVLISSGGEPVSLLSLDVSEEGIDRVMWVMNPAKLAPYVASLQD

Name Aliases LCA Taxa Group Subgroup
ECFp17483
  • RNA polymerase sigma24 factor
  • A3IC_RS0121375
Streptomyces scabrisporus DSM 41855 ECF41 ECF41s10

>ECFp17483 ECF41 ECF41s10 Streptomyces scabrisporus DSM 41855

1 MNAGADTDSLDQAARDFLAARPRLFGVAYRVLGSAVEAEDIVQEAWLRWQ
51 NADRARILEPAAFLTTVTARLAINLAQSARVRRESYVGPWLPEPVDTSAD
101 PQMGAERAEALELAVLFLLEKLNPMERAAYVLREAFDYPYAQIARILETS
151 EANTRQLVSRGRKHLAAERRERVGTTDHRRLLEVFLAAAQQGDLAALENV
201 LAADVVSYTDGGGLRGASKIPVVGRLHVSKYLVAFAPRFWPGSEVRWVEA
251 NGRPAVVVSSGGEAVALLSVDVSAEGIDRILWVMNAAKLSPYMTSPSS

>ECFp17722 ECF41 ECF41s10 Amycolatopsis balhimycina FH 1894

1 MGMSDVNVVSATVDAAEDFQSVRPRLFGIAYRVLGRAADAEDVVQEVWIR
51 WQGTDRARVHDRVAYLVKVTTNVALNVAVSARFRREIAVGDQLPERIPGT
101 EDPTQASERLEDLQYAVQLLVQWLSPAERAVFVLREAFGYRFGEIAETLA
151 ISNANARQLARRARAHLAGRRSEPVQAVECDRLVRVFLDAAQDGAVARLE
201 HVLRDDVITGSARSPLAAAG

>ECFp17964 ECF41 ECF41s10 Streptomyces corchorusii

1 MHAGAHPDTLDQATKDFLAARPRLFGIAYRVLGSAAEAEDVVQETWLRWQ
51 NTDRTKVLEPAAFLTTVATRLAINLAQSARVRRESYVGPWLPEPVDTTED
101 PQLGAERAEALEMAVLLLLEKLNPVERTAYVLREAFDYPYGRVSEILETS
151 EANARQLVSRARRHLAAERRERVTPAAHRRLLEVFLSAARTGDLSVLEDV
201 LTADVVSYSDGGGIRGASKIPVIGRPHVSRYLVAFAPRFWPQADVRWVEA
251 NGLPAVLVSSGGQAVALLSVDISTEGIDRLMWVMNPAKLAPYVASLHD

>ECFp18084 ECF41 ECF41s10 Streptomyces antibioticus

1 MDEHQQLTEGSLDEAANAFERLRPQLFGIAYRILGSVSEAEDVVQDVWPR
51 WQGANRSAVRNPRAFLAKITTRLAINVAQSARVRREAYVGPWLPEPVDTS
101 VDPQVGAERGEALELAVLLVLQKLNPVERAAYVLREAFGYAYDDIAGMLQ
151 LSQANTRQILSRARKRLSAERREPVEAAQHRRLVEAFVAAAQHGDVAALE
201 SVLSADVVAYADGNGMRGVARVAIVGAEHVARVTAFAKKFFPVAEYSVAE
251 ANGLPSLLLVQNGVTVALVSVTVGPDGVDGLYWVLAPDKLRAYERSSRRL
301 TGRP

>ECFp18172 ECF41 ECF41s10 Streptomyces sp. NRRL B-24085

1 MRAGAHPDTFDRGLDDFLAARPRLFGIAYRILGSAVEAEDIVQDAWLRWQ
51 NTDRAQIHEPAAFLTTVTTRLAINLAQSARVRRESYVGPWLPEPVDTTQD
101 PHLGAERAEAVELAVLLLMEKLNPIERAAYVLREAFDYPYQRVADILETS
151 DANARQLVSRARKHLGAERKESVSPAAHRRLLEGFLSAARTGDLSTLEDL
201 LTSDVVSYSDGGGIRGASRIPVIGRDHVSRYLAAFAPRFWPDAETRFVEA
251 NGRPAVLVARDNAPVALLCVDASEAGIERIMWVMNPVKLNPYVLSLGA

>ECFp18259 ECF41 ECF41s10 Streptomyces sp. 142MFCol3.1

1 MHAGDDADSLDRATKDFLAARPQLFGIAYRMLGSSVEAEDILQEVWVRWQ
51 KADRTNILEPAAFLTTVTTRLAINHAQSARVRRESYTGPWLPEPVDTSQD
101 PQLGAERAEALELAVLVLLEKLNPVERAAYVLREAFDYPYKQVADMLDTS
151 EANTRQLVSRARKHLAAERKEQVSRADHRRLLEVFVTAAQTGNLTELEDV
201 LAADVVSYADGNGMRGASRIPVVGRPHVSKYVVAFRPRFWPQSDVRWVEA
251 NGRPAALVTSGGNPMALLSIDVSADGIDRLMWVLNPDKLAPYMASLNA

>ECFp18275 ECF41 ECF41s10 Streptomyces puniciscabiei

1 MDEQQQLTDNSLDEAANAFERLRPQLFGIAYRILGSVSEAEDVVQDVWPR
51 WQGADRSAVRDPGAFLAKITTRLAINVAQSARVRREAYVGPWLPEPVDTS
101 VDPQVGAERGEALELAVLLVLQKLNPVERAAYVLREAFGYAYDEIAGMLQ
151 LSQANTRQILSRARKRLSAERREPVEAAQHRRLVEAFVAAAQHGDVAALE
201 SVLSADVVAYADGNGMRGVARVEIVGAERVARVSAFAKKFFPGAEYGVAE
251 ANGRPGLLLVQNGVTVALVSVTVGPDGIDGLYWVLAPDKLRAYERSARRP
301 TGRP

>ECFp18410 ECF41 ECF41s10 Streptomyces

1 MDEHQQLTEGSLDEAANAFERLRPQLFGIAYRILGSVSEAEDVVQDVWPR
51 WQGADRSAVRNPRAFLAKITTRLAINVAQSARVRREAYVGPWLPEPVDTS
101 VDPQVGAERGEALELAVLLVLQKLNPVERAAYVLREAFGYAYDDIAGMLQ
151 LSQANTRQILSRARKRLSAERREPVEAAQHRRLVEAFVAAAQHGDVAALE
201 SVLSADVVAYADGNGMRGVARVAIVGAEHVARVTAFAKKFFPGAEYSVAE
251 ANGLPSLLLVQNGVTVALVSVTVGPDGVDGLYWVLAPDKLRAYERSSRRP
301 TGRP

>ECFp18546 ECF41 ECF41s10 Streptomyces sp. NRRL S-813

1 MQAGAHPDALDQATKDFLSARPRLFGIAYRVLGSATEAEDVVQETWLRWQ
51 NTDRAKVHEPAAFLTTVATRLAINLAQSARVRRESYVGPWLPEPVDTAQD
101 PQLGAERAEALEMAVLLLLEKLNPVERTAYVLREAFDYPYGRVSEILETS
151 VANARQLVSRARRHLAAERRERVTPAAHRRLLEVFLSAARTGDLSVLEDV
201 LTADVVSYSDGGGIRGASKIPVIGRPHVSRYLVAFAPRFWPQADIRWVEA
251 NGLPAVLVSSGGQAVALLSADISTEGIDRLMWVMNPAKLEPYVASLRD

Name Aliases LCA Taxa Group Subgroup
ECFp18831
  • RNA polymerase subunit sigma-24
  • AQI96_40410
  • ... more
Streptomyces canus ECF41 ECF41s10

>ECFp18831 ECF41 ECF41s10 Streptomyces canus

1 MHAEADANSLQQATQHFLAARPQLFGIAYRLLGSTVEAEDILQETWLRWQ
51 NTDRTKVAEPTAFLTTITTRLAINLAQSARVRRESYVGPWLPEPVDTVQD
101 PQLGAERAEALELAVLFLLEKLNPVERGAYVLREAFGYPYPQIAGILETS
151 EANARQLVSRARKHLAAERRERVSPSDHRRLLRVFLTAAQTGDLAVLEDV
201 LTADVVSYSDGGGSRGASKIPVFGRVHVSKYLVAFAPRFWPQSEVRWVEA
251 NSRPAVLISSGGVAVALLSVDVSVEGIDRIMWVMNPDKLSSYVASLND

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more