ECF proteins of ECF subgroup ECF41s10

Displaying ECF 321 - 340 of 392 in total
Name Aliases LCA Taxa Group Subgroup
ECFp11898
Streptomyces canus ECF41 ECF41s10

>ECFp11898 ECF41 ECF41s10 Streptomyces canus

1 MSVEPSLTTPDDLEDAVAVFVHHRKRLFGIAYRILGSTVEAEDVVQEVWL
51 RWQKTDRSVVLSPAAFLSSAATRLAINVAQSARVRRETYIGPWLPEPVDT
101 GADPEVGAERAEAVEMALLLVLEKLTPVERAAYVLREAFDYAYAEIADML
151 EVSLVNVRKIVSRARRHLLDERRESVDAAEHRRLLGAFVSAARTGDVASL
201 EALLAPDVVSLSDGNGMRGCARVPVQGRARVARLATYRQLWREAVPELVD
251 ANGATGVLVHRDGRTLAFMTAAASKHGVHQVMWVFEPSKIAAFVASRSRF
301 TTSPGAVPDSV

>ECFp12211 ECF41 ECF41s10 Streptomyces lavenduligriseus

1 MRAGAQPGSLDRATKDFLSARPQLFGVAYRILGSAVEAEDVVQETWVRWQ
51 NTDRAQVREPAAFLTTVATRLAINVAQSARARRESYVGPWLPEPVDTAQD
101 PQLGAERAEALEMAVLLLLQKLNPVERTAYVLREAFDYPYRRVAEILETT
151 EANARQLVSRGRRHLAAERKEPVTPEAHRRLLEVFLSAARTGDLLVLEGV
201 LAADVVSYSDGNGIRGASRIPVVGRPHVSRYLVAFAPRFWPRAETRWVEA
251 NGRSAVLVSSGEQPVALLTADISADGIGRLMWVMNPAKLAPYVASLSD

>ECFp12303 ECF41 ECF41s10 Actinobacteria bacterium OK006

1 MHDEPSPTASDLDEAVSVFVQHRARLFGIAYRILGSAAEAEDVVQEVWLR
51 WQRTERSVVVSPAAFLSSTATRLAINVAQSARVRRETYIGPWLPEPVDTS
101 SDPEVGAQRAEALELALLLVLEKLSPTERAAYVLREAFDYSYPEIAHMLR
151 LSLVNARKIVSRARKHLSDEQRESVDTVEHRRLLNAFVSAARTGDVASLE
201 ALLTPDAVSLSDGNGIRGAARVPVLGRARVANLATAYPRFWGSVGVEFVA
251 ANGRMGAMIHRDGEPSTFMTIAAESEGIYRVMWVFNPKKIAAFLNSRSRS
301 TTALRPAPSGA

>ECFp12423 ECF41 ECF41s10 Streptomyces diastatochromogenes

1 MTSDLDEAVSAFVQHRARLFGIAYRVLGSVVEAEDVVQEVWLRWQKTDRS
51 VVVSPVAFLSSATTRLAINVAQSARVRRETYIGPWLPEPVDTSLDPEVGA
101 QRAEALELALLLVLEKLSPTERAAYVLREAFDYSYPEIAGILQLSVVNVR
151 QIVSRSRKRLSGEPRASVDAVEHRRLLDAFVSAARTGDVASLEAVLTPDI
201 VSLSDGNGLRGAARVPVVGRARVANLATATPRFWREADLGLVQANGRTSV
251 MMYRDGSPTAILTIAASREGIHKVMWVFNPSKIAAFLDSRARCATVPGLA
301 SAHG

>ECFp12590 ECF41 ECF41s10 Streptomyces sp. SPMA113

1 MRDGDDAGSLDQAMKDFIAARPRLFGIAYRVLGTSADAEDIVQETWLRWQ
51 RTDRSGIQEPAAFLTTVTTRLAINLAQSARMRRESYVGPWLPEPVDTRAD
101 PQLGAERAEALDLAVLFLLEKLNPVERAAYVLRDAFDYPYKRIADILETS
151 EANTRQLVSRAKKHLSAERREPADPAAHRRLLEVFLTAARTGDLTVLEDV
201 LTKDVASYSDGGGARGASRIPVIGRPRVSKYLAAFAPRFWPQADIRWVEA
251 NGRSAVLVSAGGNAVALLCVEVSVRGIERIMWVMNPAKLAPYVASLTD

>ECFp12766 ECF41 ECF41s10 Streptomyces sp. CNH189

1 MDARDEADSLERATEDFLTARPQLFGIAYRVLGSSAEAEDVLQETWVRWQ
51 NTDRSGVKEPTAFLTTITARLAINVAQSARVRRESYVGPWLPEPVDTRHD
101 PQLGAERAEALEMAVLLLLEKLNPVERAAYVLREAFDYPYRQVAEILETS
151 EANTRQLVSRARKHLVAERKEPVSPADHRRLLEVFLAAAQTGDLRVLEDV
201 LAADVVSYADGGGIRGASRIPVVGRPHVSKYLAAFAPRFWPPAETRWVEA
251 NGRPAVLVTAGGSPVALLSVDASADGIDRIMWVMNPEKLAPYVESISA

>ECFp12988 ECF41 ECF41s10 Streptomyces sp. NRRL F-5123

1 MHAGDDLGSLDRATREFVAARPRLFGIAYRVLGSAVEAEDVVQDTWLRWQ
51 GTDRAGINEPAAFLATVTTRLAINVAQSARVRRESYTGPWLPEPVDTGAD
101 PQLGAERAEALDLAVLFLLEKLKPVERAAYVLREAFDYPYRRIAEILETS
151 EPNTRQLVTRARRHLAAERRGPVSRTEHRRMLEAFLAAAQTGDLSVLEEL
201 LTEDVVSYSDGGGMRGASKIPVVGLSHVSAYLAAFAPYFWPDSDVRWVEA
251 NGMPAVLVSEAGEAKALLCADVSARGIERIMWVMNPAKLAPYVASLDA

Name Aliases LCA Taxa Group Subgroup
ECFp13054
  • RNA polymerase sigma24 factor
  • AAW13_RS39095
Streptomyces humi ECF41 ECF41s10

>ECFp13054 ECF41 ECF41s10 Streptomyces humi

1 MRAGAHPDTSDRGLDDFLSARPRMFGIAYRILGSAVEAEDIVQDAWLRWQ
51 NTDRAQIHEPAAFLTTVTTRLAINLAQSARVRRESYVGPWLPEPVDTTQD
101 PHLGAERAEAVELAVLLLMEKLNPVERAAYVLREAFDYPYQRVADILETS
151 DANARQLVSRARKHLGAERKERVSPAAHRRLLEGFLSAARTGDLSTLEDL
201 LTSDVVSYSDGGGIRGASRIPVVGRDHVSRYLAAFAPRFWPDAETRFVEA
251 NGWPAVLIARDNAPVALLCVDASEDGIERIMWVMNPVKLNPYVLSLGA

>ECFp13154 ECF41 ECF41s10 Streptomyces sp. NRRL WC-3626

1 MHPETPPTDSTLDEAVSVFVELRPRLFGIAYRVLGSAVEAEDVVQEVWLR
51 WQRTDRSVVISPVAFLSSTTTRLAINVAQSARVRRETYIGPWLPEPVDTS
101 ADPALGAQRAEALELALLLVLQRLNPTERAAYVLREAFDYTYAGIAEMLG
151 LTVVNVRKIVSRARRHLTAEQHGTVDAVEHRRLLEAFVSAARTGNITSLE
201 SLLAPDVVSLSDGNGIRGAARVPVLGRARVANLSTAARRFWPGTEVRFVE
251 ANGRGGVLLYRDGRPSTFMTIAASREGVHRVLWQFDPGKITSFLRSRPRL
301 AAA

>ECFp13428 ECF41 ECF41s10 Streptomyces

1 MDEHQQLTEGSLDEAANAFERLRPQLFGIAYRILGSVSEAEDVVQDVWPR
51 WQGADRSAVRNPRAFLAKITTRLAINVAQSARVRREAYVGPWLPEPVDTS
101 VDPQVGAERGEALELAVLLVLQKLNPVERAAYVLREAFGYAYDDIAGMLQ
151 LSQANTRQILSRARKRLSAERREPVEAAQHRRLAEAFVAAAQHGDVAALE
201 SVLSADVVAYADGNGMRGVARVAIVGAEHVARVTAFAKKFFPVAEYSVAE
251 ANGLPSLLLVQNGVTVALVSVTVGPDGVDGLYWVLAPDKLRAYERSSRRL
301 TGRP

Name Aliases LCA Taxa Group Subgroup
ECFp13434
  • RNA polymerase subunit sigma-24
  • AOK17_RS16520
Streptomyces phaeochromogenes ECF41 ECF41s10

>ECFp13434 ECF41 ECF41s10 Streptomyces phaeochromogenes

1 MHAEDDAQSLERATQEFIAARPQLFGVAYRVLGSSTEAEDIVQEAWLRWQ
51 NTDRREIVEPKAFLTTVTARLAINLAQSARMRREAYVGPWLPEPVDTSQD
101 PNMGAERAEAVEMAVLLVLEKLNPVERAAYVLRQAFDYPYPQIAEIVDTS
151 EANARQLVSRARKHLAAERREPVDRAEHQRLLKVFLTAAQTGDLATLEHV
201 LSEDVVSYADGGGIRGASKIPVVGRQHVSRYLEAFAPRFWPGAETRWVEA
251 NDRPAVLVSSGGNPVALLCVDASSRGLERIMWVMNPAKLAPYVASLAA

>ECFp13635 ECF41 ECF41s10 Streptomyces aurantiacus

1 MDAGHDVSPLDTATKQFVAARPRLFGIAYRMLGSAVEAEDVCQDTWVRWQ
51 NADRTNVVEPVAFLTTVATRLAINTAQSARVRREAYVGPWLPEPIDTGAD
101 PQVGAERTEAVEMAVLLLLEKLNPVERAAYVLREAFDYPYRELADILETS
151 EANTRQLVSRARKHLATERRERVSRDEHQRLLKVFLTAAQTGDLKSLEQV
201 LAADVVSYSDGGGVRGASRIPVVGLPHVSRYLVAFAPRFWPEADIRWVEA
251 NGRPAVLVRSGGNAVALLTVDVSAEGIDRIMWVMNPAKLAPYMASLDN

>ECFp13651 ECF41 ECF41s10 Streptomyces sp. NRRL F-5123

1 MHLQAPPVESTLSEAVSVFVELRPRLFGIAYRVLGSAVEAEDVVQEAWLR
51 WQRTDRTLVNSPVAFLSSTTTRLAINVAQSARVRRETYIGPWLPEPVDTS
101 NDPEVGAERAEALELALLLVLEKLAPTERAAYVLREAFDYAYPEIGRILQ
151 LSPVNVRKIVSRARKHLSDDQRDSVNAAEHRKLLQAFVAAARQGDVASLE
201 ALLTPNVVSLSDGNGIRGAARVPVLGRARVANLSTAYPRFWPTVEAEPVE
251 ANGRSGVLLHRNGRPATFMTIAATCRGIHQVMWVFNPSKIAAFLHSRSCD
301 AAVGGA

>ECFp13731 ECF41 ECF41s10 Streptomyces sp. HGB0020

1 MRAGDDTGSLDRATREFMAARPRLFGIAYRVLGSATEAEDVVQEAWLRWQ
51 RTDRTEIVDPVAFLVTVTSRLAINVAQSARKRHETYTGPWLPEPVDTTRD
101 PQLGAERAEALDMAVLFLLEKLNPVERAAYVLREAFDYPYRQIAEMLETS
151 EANTRQLVSRARRHLSAERREPASPEAHRRLLEVFLAAAQNGDLATLEDV
201 LTADVVSYTDGGGIRGASRIPVVGRLHVAKYLAAFAPRFWPGAQVREVEA
251 NGRPAMLVSSGGKAVALLNIEASERGIERLLWVMNPAKLAPYVASLDG

>ECFp137798 ECF41 ECF41s10 Streptomyces gancidicus BKS 13-15

1 MHAGASPGTLDQATKDFLSARPQLFGIAYRVLGSAAEAEDIVQETWLRWQ
51 STDRSKVHEPAAFLTTVATRLAINVAQSARVRRESYVGPWLPEPVDTTQD
101 PHLGAERAEAVEMAVLLLLEKLNPVERAAYVLREAFDYPYGRIAEILETS
151 EANTRQLVSRGRKHLSAERKEAVTPTAHRRLLEVFLSAARTGDLSVLEDV
201 LTADVVSYTDGNGMRGASRIPVVGLPHVSHYLVAFAPRFWPQTQVRWVEA
251 NGRPAVLILSGEKAVALLTADISADGIDRLMWVMSPAKLAPYVASLRD

Name Aliases LCA Taxa Group Subgroup
ECFp138063
Streptomyces rubidus ECF41 ECF41s10

>ECFp138063 ECF41 ECF41s10 Streptomyces rubidus

1 MYPEPDPEPSSIDEAVAVFVQLRPCLFGIAYRVLGSAVEAEDVVQEVWLR
51 WQKTDRSAVISPAAFLSSATTRLAINVAQSARVRRETYVGPWLPEPVDTS
101 ADPQLGAEQAQDVELALLLLLERLNPTERAAYVLREAFDYPYPQIAEILE
151 LSLVNVRQIVSRARKHLSDERRETVDATEHRRLLDAFTCAARTGDVSALE
201 TLLAPDHDCPYGPDGPGLPLLCPEPAVNVR

>ECFp138298 ECF41 ECF41s10 Streptomyces sp. DI166

1 MDGSLTAAADSFQRLRPRLFGIAYRVLGSVVEAEDVVQEVWLRWQRADRE
51 PVLDPGAFLAKTTTRLAINVAQSARVRREAYVGPWLPEPVDTGTDPQLGA
101 ERGEALELAVLLVMEKLNPVERAAYVLREAFDYGYGEIAQFLELNQANVR
151 QIVSRARKRLADGRREPVDTAQHRRLLDAFVAAARDGDVAALESVLSADV
201 VTYADGNGLRGVAQVEIVGAERSARVTVFAHKFFPDAEYSVAEANGRPCL
251 RLDVDGRTVALVDITTGPDGIDAMYWVIAPEKLRAYDRSRLGA

>ECFp138639 ECF41 ECF41s10 Streptomyces sp. MnatMP-M27

1 MRDGDDAGSLDQAMKDFIAARPRLFGIAYRVLGTSADAEDIVQEAWLRWQ
51 RTDRSGIQEPAAFLTTVTTRLAINLAQSARMRRESYVGPWLPEPVDTRAD
101 PQLGAERAEALDLAVLFLLEKLNPVERAAYVLRDAFDYPYKRIADILETS
151 EANTRQLVSRAKKHLSAERREPADPAAHRRLLEVFLTAARTGDLTVLEDV
201 LTKDVASYSDGGGARGASRIPVIGRPRVSKYLAAFAPRFWPQADVRWVEA
251 NGRSAVLVSAGGNAVALLCVEVSVRGIERIMWVMNPAKLAPYVASLTD

Name Aliases LCA Taxa Group Subgroup
ECFp13887
Streptomyces rubidus ECF41 ECF41s10

>ECFp13887 ECF41 ECF41s10 Streptomyces rubidus

1 MHADHDTASLEQATEDFSSARSQLFGIAYRILGSVAEAEDIVQDAWLRWQ
51 KTDRADIREPAAFLATMTTRLAINTAQSARVRRETYIGPWLPEPVDTSLD
101 PQLGAERAEALEMAVLFLLEKLNPVERAAYVLRQAFDYPYKQIADILDSS
151 EANARQLVSRARKHLAAEHREPATPAAHRRLLEVFLEAAKTGNMPVLEDV
201 LAEDAVSYTDGNGARNAAKSPVFGSESIAGFLAAFAPRFWPGTETRWIEA
251 NGRPAALVSSHGKPVVLLSVEVSERGIERAMWIMNPDKLSRLATS

>ECFp14078 ECF41 ECF41s10 Streptomyces sp. NRRL WC-3626

1 MGNAAEAEDVVQDTWLRWQNTDRTRVQDPPAFLTRITVRLALNVTRSARV
51 RHETGFGPSAAEPVDTGADPAVRAERAEALDAALCLLVERLGPTERAAYV
101 LRVAFDCPYSQIAEDLRISQVYTRQIVSRARKHLAGGRRTTVSPGEGRRF
151 REAFAGAARSGDLSELRTALTCS

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more