ECF proteins of ECF subgroup ECF41s10

Displaying ECF 301 - 320 of 392 in total
Name Aliases LCA Taxa Group Subgroup
ECFp19061
  • ECF family RNA polymerase sigma factor
  • BN159_8287
  • ... more
Streptomyces davaonensis JCM 4913 ECF41 ECF41s10

>ECFp19061 ECF41 ECF41s10 Streptomyces davaonensis JCM 4913

1 MDERAAPTGDSLTAAAAAFQKLRPRLFGIAYRVLGSVVEAEDVVQEAWVR
51 WQGTDRDAVLDSGAFLAKTTTRLAINVSQSARVRREAYVGPWLPEPVDTS
101 VDPQVGAERGEALELAVLLVLEKLNPVERAAYVLREAFDYAYDEIAGMLE
151 LSQANTRQIVSRARKRLSAERREAVDAAQHRRLLDAFVAAARDGDIAALE
201 SVLSADVVTYADGNGLRGVARLEIVGAVRSARVTAFTHKFFPGADYSVVE
251 ANGRPCLRLTADGATVALVSVTAGADGIDGLYWVIAPDKLRAYDRSAHRA
301 VARP

Name Aliases LCA Taxa Group Subgroup
ECFp19154
  • RNA polymerase subunit sigma-24
  • AOK17_RS21220
Streptomyces phaeochromogenes ECF41 ECF41s10

>ECFp19154 ECF41 ECF41s10 Streptomyces phaeochromogenes

1 MGAVEEATHSEPPGKSTLDEAATVFVGVRRQLFGIAYRMLGSAAEAEDVV
51 QEAWLRWQSTDRTVVLDPPAYLATVTTRLAINVAQSARVRRETYVGPWLP
101 EPVDTSADPQVGAERGEAVELAVLLVLEKLTPTERAAYVLREAFDYPYEQ
151 IAAILETGQANARQLVSRARRHLAAERREPVGAGEHRRLLEAFLAAARTG
201 DLAALEELLAEDVVSYSDGGGVRGASRIPVLGNSRVAKYLAAFAPRFWPG
251 AEVEWAEANGRPAVLVSHEGRAVALLAVDASVRGIERIMWVMNPAKLDGY
301 VRSRSGSREAPQVP

>ECFp19174 ECF41 ECF41s10 Lechevalieria aerocolonigenes

1 MSKLDQAESAFASARPRLFGIAYRMTGSVADAEDLVQEVWLRWQLADRES
51 VLNPEAYLATAITRLAINESQTARARRETYVGPWLPEPVDTSADPQLGAE
101 QGAVLELAVLMLLEKLTPTERAAYVLREAFDYPYREIAEIVQNSEVAARQ
151 LVSRARKHLADERKVPVERADQRKLLEAFVAAAQAGDLAGLEKLFAEDVV
201 SYSDSNGAIRAAGRPLFGAASLAKIISGWAPSFWAGAEATYVEVNGLDAI
251 RLRKDEHTYAVITVTATAEGIDNVLWLVNPEKLGAFR

Name Aliases LCA Taxa Group Subgroup
ECFp19212
Gordonia sp. NB4-1Y ECF41 ECF41s10

>ECFp19212 ECF41 ECF41s10 Gordonia sp. NB4-1Y

1 MSVHDLEDAVQVFAGHRRRLFGIAYRMLGTVSDAEDIVQETWIRWQGTDR
51 SRVTDPAAFLTTITTRLSINVLQSARSHRETYIGPWLPEPVNTDDDPALG
101 AERAEALQFAILLTLEKLTPAERAAYILREAFDYPYPRIADILSTTVVNA
151 RQLVSRARSHLASARHADVEPKHQRRLLRAFLTAAQKGDAQDLEELFADD
201 VVSYSDGNGIKLAARIPVVGRTRVAKFVAAFAHHFWTGKHIDWVQVNGQP
251 AAALSEEGTVTTVVVVTTSKDGIRQLLWVISPDKLGHVTSVSV

Name Aliases LCA Taxa Group Subgroup
ECFp1922
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • RNA polymerase sigma24 factor
  • ... more
Kribbella flavida DSM 17836 ECF41 ECF41s10

>ECFp1922 ECF41 ECF41s10 Kribbella flavida DSM 17836

1 MPSIADPSAEPHPPDSDLEQAARVFAEVRPRLFGIAYRMLSSAAEAEDLV
51 QEVWLRWQTCDRSAVTNPAAYLATTTTRLAINAIQSARVRRETYVGPWLP
101 EPVDTSADPYLGAERGDALELAVLVLLERLKPNERAAYVLREAFDYPYPQ
151 IAEILQLHEPAVRQLVSRARKRVTSDRRTPVSEPEQRQLLSAFISAARSG
201 DLAALENLFAAGVSSYSDGGGVVRAARIPVHGADRVAKFVRAFAGHFWGG
251 IEVEWRTLNGRQAALLRRDGVLAAVVSVDASADGIEQIMWLMNPDKLEAL
301 AGTG

Name Aliases LCA Taxa Group Subgroup
ECFp1921
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • RNA polymerase sigma24 factor
  • ... more
Tsukamurella paurometabola DSM 20162 ECF41 ECF41s10

>ECFp1921 ECF41 ECF41s10 Tsukamurella paurometabola DSM 20162

1 MSDTALDAFTRARPRLFGIAYRILGSAPDAEDVVQDTWLRWSGRDRTDVR
51 DPEAFLVVTATRLALTQAQSAHVRREAYVGPWFPTPVDTESDPQLGAERR
101 ATLELAVLHVLQRLGPAERAAYVLREAFGHPYDRIAEILQMREPAVRQLV
151 SRARRRLDGERRTTVSHDRLRSLLDAFLAAAHAGDIAGLEAVLAADVTSE
201 TDGGGVRRAARRPVVGGNDVARFVAGFSTRFWPDATVRRVQANGRPAALF
251 LHDGRPSALLCVVADESGITQLMWVMNPDKLADFR

>ECFp19303 ECF41 ECF41s10 Microbacterium

1 MRDLGTAVSVFAAQRRRLFGIAYRMLGTVADAEDIVQETWIRWQNTDRTQ
51 VQEPAAFLTTITTRLSINVLQSARVKRETYIGPWLPEPVNTDDDPSLGAE
101 RAEALQFAILLTLEKLTPTERAAYILREAFDYPYPRIAEIISSSAVSARQ
151 LVSRARAHLASAKQITVEPSHQRHLLEAFLAAARKGDARELEKLFAADVV
201 SYTDGNGVKLAARIPVIGRGRVAQFVAAFAHHFWTGKSIGWVEVNGQPAA
251 TLVENGEVTTMVTVTASDEGIEQLLWVMSPQKLGHITAVAT

Name Aliases LCA Taxa Group Subgroup
ECFp19322
  • RNA polymerase subunit sigma-24
  • BBK82_43795
Lentzea guizhouensis ECF41 ECF41s10

>ECFp19322 ECF41 ECF41s10 Lentzea guizhouensis

1 MTQLEQAESAFAAARPRLFGIAYRMTGSVADAEDLVQEVWLRWQTADRAA
51 VLNPEAYLATAITRLAINESQTARARRETYVGPWLPEPVDTAADPQLGAE
101 QGAVLELAVLLLLEKLTPTERAAYVLREAFDYPYREISEIVQTTEVAARQ
151 LVSRARKHLADSRRTPVAPQRQRELLEAFVAAAQAGDLAGLEKLFAADVV
201 SWSDSNGAVRAAGRPLHGAASLAKIFAAWAPTFWTPRDVSYVEANGQWAI
251 RLQREGEVYGVITVTASEEGIDQVMWLVNPEKLGQFA

>ECFp19395 ECF41 ECF41s10 Streptomyces chartreusis NRRL 12338

1 MGAAADAFERQRPRLFGIAYRVLGSVSEAEDVVQEVWLRWQDADRSAVLD
51 HGAFLAKITTRLAINVAQSARVRREAYVGPWLPEPVDTSVDPQVGAERGE
101 ALELAVLLVLERLNPVERAAYVLREAFDYAYDEIAGMLQLSQANTRQIVS
151 RARKRLSAERREPVDSAQHRRLLEAFVAAARHGDVAALEDVLSADVVAYA
201 DGNGMRGVARLEIAGPERVARVTAFARKFFPGAEYVIVEANGRPSLLLAR
251 DGAAVALVSATVGPGGIDGLYWVLTPEKLRAYERSARRLTDRP

>ECFp19520 ECF41 ECF41s10 Mycolicibacterium smegmatis MKD8

1 MDPASSSASDPAWTDLSEAEAVFTRVRPRLFGVAYRMTGTVAEAEDAVQE
51 AWLRWQDTDRAAVTDPVPFLMTVVTRICLNVLQSARARHETYIGPWLPEP
101 VDTTADPALGAERGAALELATLMLLERLAPPERAAYILREAFDYPYEQIA
151 ETVGVSVPNARQLVSRARRRLTTRRAAPVATAEQDRLLRAFVTAARSGDL
201 DALEEILAEDVVSHTDGNGARNAAQIPVVGRTTVAKFVRAFRNRLWPGAS
251 LRWITANGHSAVLVVHDDSPAAFLTVAASADGIHRLLWVLAPEKLAGIAQ
301 AQGR

Name Aliases LCA Taxa Group Subgroup
ECFp19552
  • hypothetical protein
  • AA090_RS23845
Jiangella alkaliphila ECF41 ECF41s10

>ECFp19552 ECF41 ECF41s10 Jiangella alkaliphila

1 MDTQLLEAGRDLDRATSIFMGQRPRLFTIAYRVLGSAPEAEDVVQEAWIR
51 WQRTDRTVVLDHGAFLSTTVVRLAINVRQSARRRHELDVGPELPEPPESP
101 DDRNGPDVQAERREAVELAVQLLMERLTPAERAAYVLREGFAYPYRRISD
151 VLQLRVAHARQLVRRARQRLSSGRTAPVDPAGRRRLVEAFLAAARAGDLT
201 VLEGVLVSEAAVESGRRDAPRVSRPAPLPGRTR

Name Aliases LCA Taxa Group Subgroup
ECFp19543
  • RNA polymerase sigma24 factor
  • RNA polymerase sigma-70 factor, TIGR02957 family
  • ... more
Terriglobus roseus DSM 18391 ECF41 ECF41s10

>ECFp19543 ECF41 ECF41s10 Terriglobus roseus DSM 18391

1 MDSHEASLQNAVDVFQRTRPRLFGVAYRVLGTAAEAEDVVQDAWLRWQTT
51 DRNAVKDPTAFLVTTTTRLALNVAQSARAQRETYIGPWLPEPVDTSADPY
101 LGAERGEALSIAVLLLLEKLNPVERAAYVLREAFAYSHREIADLLDTTEG
151 NARQLASRAQKHVANGRHASVSNEERDRLLHGFIAAAQSGEVEALERLLA
201 EDVVSYSDGGGIVTAARVPLLGRTRVAQVVAGFHERFWVGAEVRWSQGNG
251 QSSALVLRDGLLAAFISVEATTAGIQQIHFTLSPVKLRALAATL

Name Aliases LCA Taxa Group Subgroup
ECFp19701
  • RNA polymerase subunit sigma-24
  • OK074_RS00940
Actinobacteria bacterium OK074 ECF41 ECF41s10

>ECFp19701 ECF41 ECF41s10 Actinobacteria bacterium OK074

1 MEEAAVVFTRVRPRLFGIAYRMLSSVTEAEDLVQDVWLRWQNYDRAKVTN
51 PAAFLSTTTTRLAINELRSARVRRETYIGPWLPEPVDTGADPYLGAERGS
101 ALELAVLILMERLSPNERAAYVLREAFDYPYPQIADILRASEAAVRQMVS
151 RARKRVAGERRTPVTAAEQRHLLTTFVTAARSGDLAALERLFAADVTSYS
201 DGNGALGVARRPVVGVSRVAEFFARAADRFWVGVEVRWVHTNGQPSALLR
251 RDGTALAVLTVDASTEGIEQLLWVFNPAKIAAVSVPAD

Name Aliases LCA Taxa Group Subgroup
ECFp19788
  • hypothetical protein
  • H284_RS0112395
Cryocola sp. 340MFSha3.1 ECF41 ECF41s10

>ECFp19788 ECF41 ECF41s10 Cryocola sp. 340MFSha3.1

1 MEQDDLDTAAATFAAVRPRLFGIAYRMLGTVADAEDIVQDTWERWQRTDR
51 SAVREPAAFLATAATRLAINQAQSARVKRETYIGPWLPEPVDTSADPSLG
101 AERGEALEFAVLVLLEKLTPTERAAYVLREAFDYPYPQIAEIIQGSEASA
151 RQLVSRARKHLAEERHVREVDHAQRKRMLEAFLEAAQSGDIAELERIFTA
201 DIVSYSDGGGLARASRIPVFTRETVAKYVHAFADRFWDGTVRLIEANGGP
251 AAVLVRDGAVVAFIALDVTADGIRRLQWVLNPQKLERIPVPA

Name Aliases LCA Taxa Group Subgroup
ECFp19914
  • RNA polymerase sigma24 factor
  • K323_RS0102980
Glaciibacter superstes DSM 21135 ECF41 ECF41s10

>ECFp19914 ECF41 ECF41s10 Glaciibacter superstes DSM 21135

1 MPAESSAASEIERALSTFATVRPRLFGIAYRMLGSASEAQDIVQEVWIRW
51 QTYDRSTVRDPAAFLATTTTRLAINAVTSARVRRETYIGPWLPEPVDTSA
101 DPLLGAERGEALEFAVLLILEKLSPTERAAYVLREAFDYPYSQIAEVIQQ
151 TEASSRQLVSRARKHLAEERRASVSASEQQRLLDAFVGAAQSGNLAALEE
201 LLAEDVVSYSDGGGVVRASRIPVLGRDHVSKYITAFASRFWEGVSVAPVL
251 ANGQASVRLSRDGIDFAVVSITASAEGIDQVLWMMNPGKLGRMTAPIA

>ECFp12780 ECF41 ECF41s10 Streptomyces sp. 351MFTsu5.1

1 MDKPPLPADGSLDAEADAFQRLRPRLFGIAYRMLGSVSEAEDVVQDAWLR
51 WQGADRAGVLNPGAFLAKTTTRLAINVAQSARVRREAYVGPWLPEPVDTS
101 VDPLVGAERGEALELAVLLVLEKLNPVERAAYVLREAFDYPYDEIAGIVR
151 LSQANVRQIVSRARKRLSAERRERVGAAEHRRLLDAFVAAARDGDVAGLE
201 SVLSADVVAYADGNGLRGVARLEVVGAGRVAKISAFVRKFLPGAEFAFTE
251 ANGLPGLLLRRNGETVGLVSATVGPDGIDGLYWVLAPEKLRAYERSSGRV
301 RAGRG

>ECFp12806 ECF41 ECF41s10 Streptomyces sp. NRRL F-5122

1 MYPEAPPADRNLAEAVTTFVELRPRLFGIAYRVLGSVTEAEDVVQEAWLR
51 WQRTDRSAVVSPAAFLSTTTTRLAINVAQSARVRRETYIGPWLPEPIDTS
101 IDPVAGAERAEALELALLLVLQKLTPTERAAYVLREAFEYDYSEIAEILR
151 LTPVNARKIVSRARKHLTDDARDSVDIQEHRRLLDAFVAAAQEGDVASLE
201 ALLTPDAVSLSDGNGLRGAARVPVVGRARVANLSTASSRFWPTAEIAPVQ
251 ANGRAGVLLYRDGRPATFMTITATRRGIHQVLWLFTSDKIAAFLGSRAHC
301 APLPSRPVDA

>ECFp10916 ECF41 ECF41s10 Streptomyces olivochromogenes

1 MRARDDADSLDQATREFMAARPHLFGIAYRVLGSVVEAEDIVQDAWLRWQ
51 NTDRADIVEPTAFLATVTSRLAINLAQSAPKRRESYVGPWLPEPVDTRVD
101 PQLGAERAEALDLAVLHLMERLNPVERAAYVLREAFDYPYKQIADMLETS
151 EANTRQLVSRARKRLSAERKEPVSPAAHRRLLEVFLSAAQTGNLSVLEDV
201 LTEDVVSYSDGGGIRGASRIPVVGRSHVSRYLAAFAPRFWPQADVRWVEA
251 NGMPAVLVSADGHSVALLCVDVSERGIERLMWVMNPAKLEPYVASLDS

>ECFp16410 ECF41 ECF41s10 Streptomyces ambofaciens ATCC 23877

1 MHAGQDLGSLEEATRQFVEARPRLFGIAYRVLGSAVEAEDVLQEAWMRWQ
51 KADRTDIVEPAAFLATVTTRLAINTAQSARVRREAYVGPWLPEPVDTSSD
101 PQVGAERAEAVEMAVLLLLERLNPVERAAYVLREAFDYPYKQVAAILETS
151 EGNTRQLVSRARKHLATERREQVSRTEHQRLLEVFLTAAQTGDLATLERV
201 LAADVVSYADGGGVRGASRIPVVGRPHVSKYLAAFAPRFWPQSDVRWVEA
251 NDRPAVLVRSEGKAVALLCIDASAEGIDRLMWVMNPDKLSPYEASLSG

>ECFp11686 ECF41 ECF41s10 Streptomyces sp. LUP47B

1 MDSLDEATRVFMAVRPQLFGIAYRVLGSSAEAEDILQEAWLRWQHTDRGA
51 VREPKAFLTTVTARLAINLAQSARVRRESYTGPWLPEPIDTRADPQLGAE
101 RAEALDLAVLFLLEKLNPVERAAYVLREAFDYPYQQIADMLETSETNTRQ
151 LVSRARKRISSERRKPVDATEHRRLMEVFLTAAQTGDLAVLEDILTEDVV
201 SYTDGNGLRGATRIPVVGVEHVSRYLAAFAPRFWPDKEIDWVEANGGPAA
251 LVSTGGTPVALLTLDISERGIEQAMWVMNPEKLARYVASQDGDTTFSS

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more