ECF proteins of ECF subgroup ECF41s10

Displaying ECF 281 - 300 of 392 in total
Name Aliases LCA Taxa Group Subgroup
ECFp173299
Minicystis rosea ECF41 ECF41s10

>ECFp173299 ECF41 ECF41s10 Minicystis rosea

1 MPALTPAESSASREPTVVFDTLRGRLFGIAYRMLGSAAEAEDLVQDVWLR
51 WQGTDRAAIDDATGFLVATTTRLAINVVTSARARREAYVGLWLPEPVDTS
101 DDPELGAAKSEALELAVLLLLERLSPTERAAYVLREAFDYPHAQIASILD
151 LTEEHVRQLVVRARKHVADERRTSVSAAEQRRLLHGFIAAAQRGDVASLE
201 ALLAADVVSRTDGGGVPRAAPVPVSGRARVAKFTASFPADFWAGATVVPV
251 VANGAAGALLLRDDVPYAFVTVAASDAGVGDVLWILNPEKLRTIASSITA
301 HRAADPSPGPAATE

>ECFp173346 ECF41 ECF41s10 Streptomyces sp. WAC00263

1 MRARDDADSLDQATREFMAARPHLFGIAYRVLGSVVEAEDIVQDAWLRWQ
51 NTNRADIVEPTAFLATVTSRLAINLAQSAPKRRESYIGPWLPEPVDTRLD
101 PQLGAERAEALDMAVLHLMEKLNPVERAAYVLREAFDYPYKRIADMLETS
151 EANTRQLVSRARKRLSAERREPVSPAAHRRLLEVFLSAAQTGNLSVLEDV
201 LTADVVSYSDGGGIREASKIPVVGRSHVSKYLAAFAPRFWPPTEVRW

>ECFp173385 ECF41 ECF41s10 Saccharothrix sp. ALI-22-I

1 MRLTDIDTAPTSDSSRMSTEAADFQSVRPRLFGIAYQLLGRAADAEDVVQ
51 DVWLRWQGADRTVVRNRIAFLVTVTTRVALNVAGSARARREIPVDRWLPG
101 QVPLSEDPTLATERSADLERAVLLLLQRLSPTERAVFVLREAFDYPFRDI
151 AERLGIGEANARQLGRRARARLAGPRDEPVHRAARDRLLTAFLDAAQVGA
201 VAHLEHLLADDVLGQGRGRAG

Name Aliases LCA Taxa Group Subgroup
ECFp17533
  • RNA polymerase sigma24 factor
  • putative RNA polymerase ECF-subfamily sigma factor
  • ... more
Actinoplanes missouriensis 431 ECF41 ECF41s10

>ECFp17533 ECF41 ECF41s10 Actinoplanes missouriensis 431

1 MADDDSHEGDDVHATMDRNELDEAATAFTRVRPRLFGIAYRMLGSATEAE
51 DLVQDVWLRWQNYDRGAVRNPAAFLATTTTRLAINNLQSARVRRETYLGP
101 WLPEPVDTSADPYLGAETGDALEFAVLILLEKLTPTERAAYVLREAFEYP
151 YPQIAVVLRTSEPAARQLVSRARKHVTSERKAPVDAAAQRELLSTFLTAA
201 RAGDLAGLENLFAAGVTSITDGNGVKHAARRVVAGATPVAKFIAAFSSFW
251 WDGVEARFVTVNGRPAAVLQHAGGVKAVLTLTASADGIDHLLWLMNPDKI
301 AAFR

>ECFp17546 ECF41 ECF41s10 Mycobacterium sp. djl-10

1 MDEFMKMRPQLFGIAYRMLGCAGEAEDALQDVWIRWQGCDRDAIREPSAF
51 LVTTTTRVCLNVLQSARVRREMTLGAAWFPEPVDIDADPSADVQRRDDVH
101 HATQVLLETLPPAERAAFILREAFDYPYAAIARILGVTDINARQLAHRAR
151 KHLAAGHRRGTAGAAEHQQLLAAFVAAAHHGHTSGLEDLLAASA

>ECFp17649 ECF41 ECF41s10 Amycolatopsis orientalis DSM 43388

1 MEELAEAASVFAQVRPRLFGIAYRMLGSVADAEDLLQDVWLRWQTCDRSA
51 VRDPGAFLATTTTRLAITASQTARARHETYVGPWLPEPVDTSADPQLGAE
101 RAAALEVAVLFLLEKLPPTERAAYVLREAFDYPYPQIADIVQTTEVNARQ
151 LVSRARKHLAAERRTPVEPAEQRRLLAAFVDAARSGDLATLEKLLAEDVV
201 SYSDGGGAVRATRIPVVGARTVAKYVRAFANRFWTGAEVRWSDANGQPAA
251 VVSHGGTVTAVLTVAAAAEGIHRVFWLMNPAKLGAYPG

Name Aliases LCA Taxa Group Subgroup
ECFp17763
Leifsonia sp. Leaf264 ECF41 ECF41s10

>ECFp17763 ECF41 ECF41s10 Leifsonia sp. Leaf264

1 MDATLDDALAAFQAVRGRLFGIAYRMLGSASEAEDIVQDAWLRWQGTDRT
51 LVQDPPAFLATVTTRLAINALHSARAQRETYIGPWLPEPVDTSADPTLGA
101 ERAEALGFAVLVMLERLTPTERAAYVLREAFAYPYEQICEIVQVSEAAAR
151 QLVSRARKHLTGERRREVPQSEQRRLLTAFLTAAKTGDLVELEHLLSEDV
201 VSYSDGGGVVRASKFPVIGRERVAKFIRAFHTHFWDGVDTVESETNGQAS
251 VLLSKDGTIFAVLTVVAGATGIDQVLWMMNPHKLEAVTLRAVV

Name Aliases LCA Taxa Group Subgroup
ECFp17874
  • RNA polymerase sigma24 factor
  • B085_RS0132230
Streptomyces sp. BoleA5 ECF41 ECF41s10

>ECFp17874 ECF41 ECF41s10 Streptomyces sp. BoleA5

1 MDLREAQEEFQAARGSLFGIAYRMLGSVSEAEDILQDAWIRWQTYDRSKV
51 ENPRAFLATTVTRLAINVLKSARARRETYVGPWLPEPVDTESDPALGAVN
101 GEALEVAVLMLLEKLTPAERAAYVLREAFEYPYAQIAEIIGQSNANARQL
151 VSRARKHLAAEKRASVVSTDHQRFLTAFVAAAKAGEVGVLEDMFTEDVVS
201 YSDGGGEVRASKFPVVGRHRVAKYHHAFADRFWVDATVEPVQVNGRPAMK
251 LSRDGTVFALLTLSVTAEGIDRVMWMMSPTKLAVLDE

Name Aliases LCA Taxa Group Subgroup
ECFp18093
  • RNA polymerase subunit sigma-24
  • M015_RS23900
Acidobacteria bacterium KBS 146 ECF41 ECF41s10

>ECFp18093 ECF41 ECF41s10 Acidobacteria bacterium KBS 146

1 MVTSELDDAASVFLSVRSRLFGIAYRMLGSANEAEDLVQETWIRWQGTDR
51 STVLDPAAFLATITIRLALNMAQSARARRETYIGPWLPEPVDTRDDPYLG
101 AERGEALSLAVLILLDKLSPAERAAYVLREAFDYPYSRIAELLESTEVNA
151 RQIVSRARRHVADGVRASAQPVEPEEQGKLLEAFMRAARKGEIAELEGLF
201 AEGVVSTTDGNGVVNAARKPVDGREKVAKFIASFAWHFWADATFALVEAN
251 GRPGLLVSRNGEVYVFAAVEMSDEGIEEIHWVMNPEKLARIAKSWPKPGD
301 TASLLQH

Name Aliases LCA Taxa Group Subgroup
ECFp18104
  • RNA polymerase sigma24 factor
  • M015_RS0119915
Acidobacteria bacterium KBS 146 ECF41 ECF41s10

>ECFp18104 ECF41 ECF41s10 Acidobacteria bacterium KBS 146

1 MSEVTTSENPSVVCLNTKADRGDDGLSAFAEVHPRLFGIAYRMLGSAAEA
51 EDMVQNVWLRWQTAARSVVENPAAFLSTTTTRMCINFVQSARSRRESYVG
101 PWLPEPVDTSCNPALGAERGEALGLAILLLLEKLSPTERAAYVLREAFDY
151 SYREIADVLQIEEANTRQLVSRARKHISDGRRSPASSEEQLRLLQVFIGA
201 AQTGDLAALKGLLAEDVVSYSDGGGIVRAAGVPVSGRERVAKFIAAFASH
251 FWMGMTLAWVETNGQASVLMSREKVPVVLATIDASAEGINQIMWIMRPSK
301 LAAISAARLSTG

>ECFp18240 ECF41 ECF41s10 Cellulosimicrobium cellulans F16

1 MAGVDERAADLTTAEQQFSAARRRLFGIAYRILGSAAEADDVLQDAWVRW
51 QTYDRSTVRNPDAFLTTTVTRLAINVAQSARVRRETYIGPWLPEPVDTSA
101 DPTLGAERGEALEVALLMLLEKLTPTERAAYVLREAFDYPYEQIAEIIGH
151 SQASVRQLVSRARRHLGEERRAPVAPEAQRRLLTAFVAAAKAGDVALLEQ
201 LFAEDVISYSDGGGAVRASKFPVVGRPRVAKYHHAFAERFWAGVEVEPAD
251 VNGHPAVKLSRDGELFAVLTVRATTDGIDRVLWMMNPQKLAAVSA

>ECFp18299 ECF41 ECF41s10 Nocardiopsis sp. RV163

1 MQSAVPREPGPLEEAAQAFTGVRPRLFGIAYRMLGSRAEAEDLVQEVWLR
51 WQRTDRGAVEDPAAFLATITTRLAVNVLKSARVRREAYVGPWPPEPVDTG
101 ADPGVGAERGAAVGLALLLLMERLTPTERAAYVLREAFDYPYDRIAAVVR
151 TSEANARKLVSRARGHLSEGRREPVDPREHRRLVGAFLSAAQAGDLAALE
201 EILAEDAVSRSDGGGRTRSSARVPVVGRNRVAGLLQAFAPRLRPGAHTGI
251 AEMNGRPGLVVSRNGTPFALLSVDASAQGIHQLLWVMNPDKIASFQRSSA
301 GVPGPHEGPSASGRPPAAGSPTG

>ECFp18418 ECF41 ECF41s10 Streptomyces mirabilis

1 MDKPAPPTDGSLAEEADAFQQLRPRLFGIAYRILGSVSEAEDVVQDVWLR
51 WQNADRGDVLNPGAFLAKITTRLAINVAQSARVRREAYIGPWLPEPVDTS
101 VDPQVGAERGEALELAVLLVLEKLNPVERAAYVLREAFDYPYDEIAGIVG
151 LTQANVRQIVSRARKRLSAERRGPVDTAEHRRLLDAFVAAARHGDMAALE
201 SVLSADVVAYADGNGLRGVARLEVVGAGRVARISAFVDKLIPGAEFVFAE
251 ANGLPSLLIRRDGETVGLVSATVGADGIDGLYWVLTPEKLRAYERSSDRL
301 VRREP

>ECFp18494 ECF41 ECF41s10 Actinomadura chibensis NBRC 106107

1 MDDVSPADLDRAAAVFAEVRPRLFGIAYRMLGSATEAEDLVQDVWLRWQT
51 ADRAAVTEPGAFLATATTRLAINVLQSARVRRETYVGPWLPEPVDTGADP
101 HLGAERGEALELAVLFLLERLTPNERAAYVLREAFDYPYPQVAEIVQVSE
151 AAARQLVSRARKHLRSERRAPVTAAAQRRLLTAFVAAARAGDLAALEEIL
201 AADVVSYSDGGGGVRASRFPVVGAERVAKYHRAFAARFWLGVDVAWADVN
251 GRTAALLHRDGEVFAVLTVDASEEGIERVLWMMNPGKLTAAGGGAGARGG
301 GGGGRP

Name Aliases LCA Taxa Group Subgroup
ECFp1854
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • AciX8_0241
Granulicella mallensis MP5ACTX8 ECF41 ECF41s10

>ECFp1854 ECF41 ECF41s10 Granulicella mallensis MP5ACTX8

1 MTIAMAEEPISETPLSVRRGLEDGEHDDGLLVFAEVRPRLFGIAYRMLGS
51 AAEAEDIVQDVWLRWQATDRNIVESPSAFLATTTTRMCINFSQSAHSRRE
101 TYVGPWLPEPVDTSSDPALGAERGEALGLAILLLLEKLSPTERASYVLRE
151 AFDYSYRQIADIIQMEEANTRQLVSRARKHIADGRRTPVSSEEQRRLLEA
201 FIGAAQKGDLATLEGLFVEDVVSYSDGGGIVRTAARAPVSGRDHVAKFIT
251 SFASHFWTGITLRWIETNGQASVLLSRDGIPVALATVDASVEGIHQIMWI
301 LRPSKLAAISQTGRL

Name Aliases LCA Taxa Group Subgroup
ECFp18571
  • RNA polymerase subunit sigma-24
  • ASD06_12685
  • ... more
Angustibacter sp. Root456 ECF41 ECF41s10

>ECFp18571 ECF41 ECF41s10 Angustibacter sp. Root456

1 MTAQDVGDARRDELDAAVGEFNASRRRLFGIAYRMLGSVAEAEDIVQEAW
51 LRWQQTDRSDVRNPAAFLTTVTTRLALNTVDSARVRREQYVGPWLPEPVD
101 TSADPSLGAETAEALELAVLLLLERVRPDQRAAYVLREAFDYPYDEIAEI
151 LDTSPANARQLVSRARKHVRSERREPVEAGEHRRLLSAFVDAARTGDLAG
201 LERVLAADVVSTSDGAGLAPRAARRPVEGRETVARFVAGFAGDWWSGTTL
251 TWVETNGRPSVLVQRGEERLALLTVAVSQGGIEQLLWVMAPAKLTAVAP

Name Aliases LCA Taxa Group Subgroup
ECFp1859
  • RNA polymerase, sigma subunit, ECF family
  • RNA polymerase sigma24 factor
  • ... more
Mycolicibacterium ECF41 ECF41s10

>ECFp1859 ECF41 ECF41s10 Mycolicibacterium

1 MSPARNTESCLTVGVSEARTGDADGDLADAVAAFTAVRPRIFGVAYRMLG
51 SVAEAEDVLQEVWLRWQKCDRRAVRDPAAFLITATTRLSINERQSARARR
101 ETYIGPWLPDPVDTGADPTLGAERAEALEFATLMLMERLTPAERAAYVLR
151 EAFDYPYGLIAETIETSQANARQLVSRARRHLAEARRHDVDPAEQRQLLT
201 AFVAAAQNGDMATLESLFAEDIVSYTDGNGIRNAARHPVVGRETVARFVC
251 AFRRRVFADAVLTWVTVNSAPAVVISHGGGPFHDGGVFETFVALTPSERG
301 ITQLLWHRLEGKVSHLG

Name Aliases LCA Taxa Group Subgroup
ECFp18669
  • RNA polymerase sigma24 factor
  • IG04_RS0122845
Lentzea albidocapillata ECF41 ECF41s10

>ECFp18669 ECF41 ECF41s10 Lentzea albidocapillata

1 MTQQLDEAESVFAAARPRLFGIAYRMTSSVADAEDLVQEVWLRWQLADRA
51 AVLNPEAYLATAITRLAINESQTARARRETYVGPWLPEPVDTSADPQVGA
101 EQGAVLELAVLMLLEKLTPTERAAYVLREAFDYPYREIAEIVQTSEVATR
151 QLVSRARKHLADERRVPVERADQHKLLEAFVAAAQAGDLAALEKLFAQDV
201 VSYSDSNGAIRAAGRPLFGAASLAKIISGWAPSFWAGSETSFVEANGLTA
251 VRLRKADGTYAVITVTASAEGIDQVLWLVNPEKLAAFQ

>ECFp18662 ECF41 ECF41s10 Sorangium cellulosum So0157-2

1 MTAPRVPEGPQPAADPFFALRPRLLGIAYRILGSRAEADDVVQDTWVRWQ
51 ATDRATVQEPTGFLVTATTRLAINVAQSARVRREAYVGPWLPEPIDTSPS
101 AELGAETQEGLALAVLVLLEKLSPTERAVYVLREVFDYPYEEIAGILDLG
151 EANVRQLLVRARKHLAGERRAPVGVEQQRRLLESFIAAAQKGDLSALERL
201 FAADVASTTDSNGRVRMAVRVPVHGRERVAKLVAGFSSRFWPGTTVTWLE
251 TNGQPSVLIRRDGVAVALASIDASAEGIEQIYWMMSPEKLATF

Name Aliases LCA Taxa Group Subgroup
ECFp18947
Agromyces aureus ECF41 ECF41s10

>ECFp18947 ECF41 ECF41s10 Agromyces aureus

1 MDANLDDALAAFEAVRGRLFGIAYRMLGSAGEAEDIVQDAWIRWQGTDRS
51 AVENAPAFLATTTTRLAINALQSARARRETYVGPWLPEPVDTSADPTLGA
101 ERAEALGFAVLVMLERLTPTERAAYVLREAFAYPYDQICEIVQVSEPAAR
151 QLVSRARKHLAGERRREATATEQRRLLTAFLTAAKTGDLDELERLFAEDV
201 VSYTDGGGVVRASKFPVVGRERVAKFVRAFHTHFWEGVSIAEADTNGQPS
251 VLLSKDGTTFAVITLVVGAEGIDQVLWMMNPHKLGAVASRAAS

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more