ECF proteins of ECF subgroup ECF41s10

Displaying ECF 221 - 240 of 392 in total

>ECFp16592 ECF41 ECF41s10 Actinobacteria bacterium OK006

1 MRARDDADSLDQATREFMAARPHLFGIAYRVLGSVVEAEDIIQDAWLRWQ
51 NTNRADIVEPTAFLATVTSRLAINLAQSAPKRRESYIGPWLPEPVDTRMD
101 PQLGAERAEALDMAVLHLMEKLNPVERAAYVLREAFDYPYKRIADMLETS
151 EANTRQLVSRARKRLSAERREPVSPAAHRRLLEVFLSAAQTGNLSVLEDV
201 LTADVVSYSDGGGIRGASKIPVVGRSHVSKYLAAFAPRFWPPTEVRWVEA
251 NGRPAVLVSADGNSVALLSVDVSERGIERIMWVMNPAKLAPYVASLDG

Name Aliases LCA Taxa Group Subgroup
ECFp16612
  • RNA polymerase subunit sigma-24
  • RNA polymerase sigma24 factor
  • ... more
Streptomyces sp. AS58 ECF41 ECF41s10

>ECFp16612 ECF41 ECF41s10 Streptomyces sp. AS58

1 MDLEPSPTTADLDEAVSVFVQHRSRLFGIAYRVLGSAVEAEDVVQEVWLR
51 WQKTDRSVVVSPVAFLSSTTTRLAINVAQSARVRRETYIGPWLPEPVDTS
101 SDPEVGAQRAEAVEMALLLLLEKLNPTERAAYVLREAFDYGYPEIAEILQ
151 LSLVNVRKIVSRARKHLSDEQRGTVDSAEHRRLLTAFVAAARTGDVAKLE
201 ALLTPDAVSLSDGNGMRGAARLPVLGSARVANLATATRQFWRTVELQLVE
251 ANGRTGVMLHRDGVPTTLLTIAATREGIYRVMWVFNPSKIAAYLTSRSRF
301 TVTSVVAAEGV

>ECFp16644 ECF41 ECF41s10 Nocardioidaceae bacterium Broad-1

1 MSVQDGLGQGRRTSVGDDLEHAAELFDESRGRLFGIAYRMLGSVSEAEDI
51 VQDAWLRWQQTDRSVVRNPVGFLTTITTRLAINCAESARVRREQYVGPWL
101 PEPVDTADDPSLGAERAEALESATLVLLERLLPDQRAAYVLREAFDYSYE
151 NIAEILGTSKVNARQIVSRARKHVRSGRRLPVDPVKHREFLTAFVAAAQV
201 GDVVRLEQLLAADVVSTSDGAGIVRLAARRPIAGRSRVARFLASWADLWW
251 TEASLTWVETNGRASVVVHRSGEPAAVLSLAVSEAGIEQIMWVMAPEKLS
301 RLIA

>ECFp16668 ECF41 ECF41s10 Streptomyces sp. NRRL S-146

1 MDQQRPLPDDALNAAADEFERLRPRLFGIAYRVLGSVSEAEDVVQDVWVR
51 WQGADRSGVLDEGAFLARITTRLAINVAQSARVRREAYVGPWLPEPVDTG
101 VDPQVGAERGEALELAVLLVLERLNPVERAAYVLREAAFDYAYDEIAGML
151 ELSQANTRQIVSRARKRLSAERREPVDTAQHRRLLDAFVAAAREGDVAAL
201 ESVLSADVVAYADGNGMRGVARLELVGPARVARVTAFAHKFFPGAEYGVV
251 EANGQPSLLLVQDGAAVALVSATVGPDGIDGLYWVLAPEKLRAYERSARR
301 VTGRP

Name Aliases LCA Taxa Group Subgroup
ECFp1670
  • ECF subfamily RNA polymerase sigma-24 subunit
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Catenulispora acidiphila DSM 44928 ECF41 ECF41s10

>ECFp1670 ECF41 ECF41s10 Catenulispora acidiphila DSM 44928

1 MSDAGQVAELDGARGALVGVRIDGGADFGGDVGDVKEGVGERVGDGADGL
51 EEAVAVFTRVRPRLFGIAYRILSSVTEAEDLVQEVWVRWQTCDRKAVRDP
101 AAFLATTAIRLAINELRSARVRREKYVGPWLPEPVETSADPYLGAERGEA
151 LQFAALLLMEKLTPNERAAYVLREAFDYSYPEIADVLGTTGAAVRQSVSR
201 ARKHMARERRVSAPAAAQRELLTKFIAAARDGDMAALEQLFAADVASVSD
251 GNGRARVGRRPVVGASRVAKFLKAMSSWFWDGVEVLWVTTNGQTSALLRH
301 DGALWGMITVSVSGEHIDQVLWMFNPEKITARSLPPGLVLDGGFAEVTKA
351 SP

Name Aliases LCA Taxa Group Subgroup
ECFp1676
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • RNA polymerase sigma24 factor
  • ... more
Terriglobus saanensis SP1PR4 ECF41 ECF41s10

>ECFp1676 ECF41 ECF41s10 Terriglobus saanensis SP1PR4

1 MHKDSPDLGSIEEDALKAFKSVRARLFGIAYRMLGSAADAEDLVQDVWLR
51 WQTTDRSVVLDAGAFLATITVRLAINEAQSARSRHETYVGSWLPEPVDTS
101 EDPYLGAERGEALEFAVLLLLEKLSATERAAYVLREAFDYPYQQIAEILQ
151 ITEANLRQHVSRARKHIADGRRASVDLTEQRRLLGAFIAAAQKGDLAALE
201 ELFAADIVSNADGGGIVRAARAPVEGRERVAKFITAVAPHFWKGVEVEFI
251 EANGQPAALIVRDGSAVALAMIDATAEGIAQILWVMRPSKLMGVSRLLQG
301 PRALL

Name Aliases LCA Taxa Group Subgroup
ECFp16821
Sorangium cellulosum ECF41 ECF41s10

>ECFp16821 ECF41 ECF41s10 Sorangium cellulosum

1 MTAPRVPEGPQPAADPFFALRPRLLGIAYRILGSRAEADDVVQDTWVRWQ
51 ATDRATVQEPTGFLVTATTRLAINVAQSARVRREAYVGPWLPEPIDTSPS
101 AELGAETQEGLALAVLVLLEKLSPTERAVYVLREVFDYPYEEIAGILDLG
151 EANVRQLLVRARKHLAGERRAPVGVEQQRRLLESFVAAAQKGDLSALERL
201 FAADVASTTDSNGRVRMAVRVPVHGRERVAKLVAGFASRFWPGTTVTWLE
251 TNGQPSVLIRRDGVAVALASIDASAEGIERIYWMMNPEKLATF

Name Aliases LCA Taxa Group Subgroup
ECFp1703
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • RNA polymerase sigma24 factor
  • ... more
Streptosporangium roseum DSM 43021 ECF41 ECF41s10

>ECFp1703 ECF41 ECF41s10 Streptosporangium roseum DSM 43021

1 MADAGSGSPEDLERAVAVFAGVRPRLFGIAYRMLGSAAEAEDLVQEVWLR
51 WQGYDRAKVDSPAAFLATTTTRLAINAAQSARVRRETYIGPWLPEPVDTG
101 ADPYLGAERSEALEFAVLLLLERLSPTERAAYVLREAFDYPYRQIADIIQ
151 LNEPAVRQLVSRARKHVLVERRTPVTGAEQRRLLTAFVTAARSGDLIALE
201 QLFAADVTSYSDGGGSVRASRFPVAGASRVAKYVKAFADHFWAGVDVAWA
251 ATNGQTSALLSRDGQVFAVLTVNASAQGIDQVLWMMNPAKITGLGLPQDS
301 PEPVDGGP

Name Aliases LCA Taxa Group Subgroup
ECFp17073
  • RNA polymerase sigma24 factor
  • RS84_RS05775
Microbacterium hydrocarbonoxydans ECF41 ECF41s10

>ECFp17073 ECF41 ECF41s10 Microbacterium hydrocarbonoxydans

1 MDERAWADEDRDVCTELDDALTTFGAHRRRLFGIAYRMLSTVADAEDIVQ
51 EAWIRWQNTDRSKVQEPIAFLTTIVTRLSINVLQSSRVRRETYIGPWLPE
101 PVNTEDDPALGAERAEALQFAILLTLEKLTPTERAAYILREAFAYPYPRI
151 AEVISSSPASARQLVSRARAHLASAKQATVDPGAQRRLLEAFLTAAQKGD
201 VRELESLFAADVVSYTDGNGVKLAARIPVSGRRRVARFVSAFSHHFWTDK
251 SIAWVEINGQPAAALTEDGQVTTVVTVTTSSDGILQLLWVMSPEKLRHAA
301 VGA

Name Aliases LCA Taxa Group Subgroup
ECFp1707
  • RNA polymerase subunit sigma-24
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Catenulispora acidiphila DSM 44928 ECF41 ECF41s10

>ECFp1707 ECF41 ECF41s10 Catenulispora acidiphila DSM 44928

1 MHAVTGSDRDDLDQAAAVFMSVRPRLFGIGYRMLGSATDAEDLVQEVWLR
51 WQTHDRSEITNPGAFLATAMTRLAINELQSARKRRETYVGPWLPEPVDTS
101 ADPYLGAERGEALEFAALLLMEKLTPNERAAYILREAFDYSYAEIADIVQ
151 STEPAVRQSVSRARKHMTRDRHAPIAAAAQRELLTTFLDAARTGDMAALE
201 QLLAADVTSLADGDGRRQVARRAVVGAPWVAKFLAAMSWFWEGIETRFTT
251 MNGQTCAVLLSGGTVYGVLAVTASQDGIDQVLWMVNPAKNAQVPVPA

>ECFp17087 ECF41 ECF41s10 Streptomyces sp. HNS054

1 MDARDASGSLDRATDDFLAARPQLFGIAYRVLGSAAEAEDVLQETWVRWQ
51 NTDRSGVKEPAAFLTTITARLAINVAQSARVRRESYVGPWLPEPVDTRHD
101 PQLGAERAEALEMAVLLLLEKLNPVERAAYVLREAFDYPYKQVAEILETS
151 EPNTRQLVSRARKHLSAERKEPVSPADHRRLLEVFLAAAQTGDMQVLENV
201 LAADVVSYADGGGIRGASRIPVVGRLRVSKYLAAFAPRFWPPARTRWVEA
251 NGSPAVLVTAGGNPVALLSVDASEDGIHRIMWVMNPEKLSPYVTSLSA

>ECFp14462 ECF41 ECF41s10 Kibdelosporangium aridum subsp. largum

1 MDAAVALELFSEVRPRLFGIAYRMLGSALDAEDLLQEVWLRWQNYDHAEV
51 KNPGAFLATVTTRLAINAGQTARARHETYVGPWLPEPVDTAADPQLGAER
101 DAAVEFAVLILLEKLTPTERAAYVLREAFDYPYPQIAEIIQVSEASARQL
151 VSRARKHLAAERRAPVSRAEQQRLLQAFVAAAKTGDLAKLEELLAEDVVS
201 YADSNGAVRGASRVPLLGRPVVAKVIKAFSNTFWIGVDITWAEVNGQPAA
251 VLRRDGHIYGVLSITASESGIDQLLWMMNPEKLAALA

>ECFp171866 ECF41 ECF41s10 Mycobacterium tuberculosis

1 MSMLLQEPANSLDQAAATFTDVRPRLFGIAYRMLGSPAEAEEIVQETWLR
51 WQHTERSAIANPAAFLALITTRLSINTVQSARVRRETGFASRLHEPIDAA
101 ADPATSAERGDAIERGLLVLLERLTPAQRAAYILREAFDYPYARIAELIR
151 LSPDNVRQLVSRSRRYLSTHRRGPVGAGAHRGLLSAFLDAAQKGNMRALE
201 EFLAADVITSSGTANDLLPHPLLASKTVRNRPPGKHDVPPPAVRSRICPG
251 TGGTCSGDRYGRPLKGSNSWT

>ECFp171869 ECF41 ECF41s10 Jiangella alkaliphila

1 MTTDTDGVADFLDVRPQLFGIAYRMLGSVAEAEDIVQDAWIRWQRTDRSE
51 VQNPAAFLTTTATRLALTAATSARVRRETYPGPWLPEPVDTSDDPALGAE
101 RAEALDLAVLLLLEKLGPAERAVYVLHEAFDYPYRRIGEILEISEANARQ
151 LARRARLALESGRAAPAPPAVRRQLLETFVSAARDGDLEALERLFTQDVV
201 ARPDGGGKVHASKVELYGAARVVLFIDNILRKYWQAAAFTVVDVNGEAGM
251 LVADGAGTPLAVLTLDATERGVERVFFVVNPDKLRQFAPHE

>ECFp171911 ECF41 ECF41s10 Microbacterium sp. cl140

1 MAHLKPAGDLPAPRTPLALWRSVDESELPGQEDGEDHSGVGAFLRSRPRL
51 FGIAYRMLGSVAEAEDVVQEAWMRWQAYDRQSVREPEAFLATTTTRLAMN
101 ELQSARARRETYIGPWLPEPIDTDADPELVAERSETLRFAILILLERLTP
151 AERAAYVLHEAFGYPYRQIAEVISTTEDAARQLASRARRRITAERRRPVG
201 DAEQRRLLQAFIDAARSGDIAALESLLTEDVVGITDGGGLANAARVPLVG
251 RERVVQVTAAVSKWIWQEATVRIVQANAQAWAVLEVSDGPVMMFTVEASE
301 EGIDRMLWLANTAKLGAVFATGAP

>ECFp171930 ECF41 ECF41s10 Rhodococcus yunnanensis NBRC 103083

1 MPRDIGSELDDAALIFNGVRPQLFGIAYRMLGSASEAEDIVQDAWLRWQA
51 CDRSKVLNPAAFLSTTTTRLAINAVQSARARHETYIGPWLPEPVDTSADP
101 ALGAERGEALGFAVLLLLETLSPTERAAYVLRESFDYPYRQIAEIIEVSE
151 ANARQLVTRARKHIAAGRRSSVSADDHRRLLAAFVDAAQTGDLDALEKLF
201 AADIVSSSDGGGVKGVLAARIRIHGDEKVAKFVAAFSSHFWTGAQITWVE
251 ANGAASVLLARDDVPYTLLTATTTPGGIAQLHWVMNPSKLGRFAPSAAAT
301 SPH

>ECFp171954 ECF41 ECF41s10 Nonomuraea jiangxiensis

1 MAVADTVPAGGPDDLEQAVEIFAGVRPRLFGIAYRMLGSATEAEDLVQEV
51 WLRWQNADRAVVENPAAFLATATTRLAINTAQSARVRRETYTGPWLPEPV
101 DTAADPYLGAERGEALELAVLVLLERLSPTERAAYVLREAFDYPYRQIAD
151 ILQLNEPAVRQLVSRARKHVLDGRRTPATRAEQRRLLTAFVTAARSGDLN
201 ALEELFAADVTSYSDGGGAVRASRIPVVGAHTVAKYVRAFARHFWTGVDV
251 AWAEANGQTAALLSRDGEVFAVLTVNASAQGIDQVLWMMNPAKITAVSAR
301 T

>ECFp171965 ECF41 ECF41s10 Microbacterium sp. cl140

1 MSVEWVNLDCAADVFAQERRRLFGIAYRMLGSVADAEDILQDAWIRWQHT
51 DRSIVKEPRALLTTVVTRLCINEMQSAHARRETYIGPWLPEPVKTEDDPL
101 LGAERGEALDLAVLLLLEKLTPTERAAYVLREALDYPYERIAVIVRSSVP
151 AARQLVSRARKHLADSRRNAVPAGEHRRLLETFLVAAQTGDVAALEDLFA
201 SDVVSYTDGNGAKLAARIPVIGRTRVAKFVAAFSSHFWTGKRIGWVEVNG
251 QPAATLSENGVVTTAVTVTAAADGIVQLLWVMSPDKLQHLTSAGA

>ECFp172028 ECF41 ECF41s10 Cellulosimicrobium cellulans

1 MSLGPRTPESPVVREDEGALDAFLSVRSRLFGIAYRMLGSATEAEDVVQE
51 AWVRWQGTDRSVVRNPAAFLTTTVTRLAINAATSARARRETYVGPWLPEP
101 VDTSDDPALGAERAEALEIATLVLLERLAPVERAVYVLREAFDYPYRRVA
151 EILDLTEANARQLARRARERLGARPSVPVDPGEHRRLLDEFVAAAHDGDL
201 ARFERYLADDVVARPDGGGKVHASRVELVGLSRVSLFLDNVWRKYWADAV
251 VHVVEANGRPALLVVVDDAPFALVSLDVTARGIEHVYLQVNPEKLGGYAA
301 AG

>ECFp172059 ECF41 ECF41s10 Kribbella sp. ALI-6-A

1 MPEPVDETAVSEADDLEEAARVFAELRPRLFGIAYRMLSSATEAEDLVQD
51 VWVRWQTCDRSVVLNPAAYLATTTTRLAINAAQSARVRRETYVGPWLPEP
101 VDTSADPLLGAERGEALEFAVLILLERLSPNERAAYVLREAFDYPYSQIA
151 EILQLSEPAVRQLVSRGRKRVSGDRRTPVDEAEQRRLLSAFVTAARTGDL
201 VALENLFAADVSSYSDGGGIVRASKIPVHGVERVAKYYRAFADRFWAGVD
251 VEIATVNGEAMGLLRMDGTVFAAVTVVASAEGINQIYWQMNPNKLAGVS

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more