ECF proteins of ECF subgroup ECF41s10

Displaying ECF 1 - 20 of 392 in total

>ECFp16550 ECF41 ECF41s10 Amycolatopsis rifamycinica

1 MADSGVGAELGGVDGLEAATAVFTRLRPRLFGIAYRMLSSVTEAEDLVQE
51 VWLRWQTYDRSAVANPEAFLATTTTRLAINVLQSARNRRETYIGPWLPEP
101 VDTGADPYLGAERGEALEFATLLLMEKLTPNERAAYVLREAFDYSYARIA
151 DILSSTEPAVRQLASRARKHIAGGRGAPVAAAAQRELLTAFLAAARSGNV
201 AALERLFTPDVTSLSDGNGRKGVARTPVVGAARVAKFLQAISTWFWDDVD
251 VRWAVTNGQASAVLLQDGGVYGLLTVGATTEGVDHVLWLVNPEKNNAVSV
301 AG

Name Aliases LCA Taxa Group Subgroup
ECFp10787
Streptomyces canus ECF41 ECF41s10

>ECFp10787 ECF41 ECF41s10 Streptomyces canus

1 MAGDLSEAVSVFVELRPRLFGIAYRVLGSAVEAEDVVQEVWLRWQRTDRT
51 LVISPVAFLSSTTTRLAINVAQSARVRRETYIGPWLPEPVDTSNDPEVGA
101 ERAEALELALLLVLQRLSPTERAAYVLREAFDYAYPDIARILGLNPVNVR
151 KIVSRARKHLTEDQRDSVDAAEHRTLLQTFVAAARQGDVAGLEALLTPDA
201 VSLSDGNGIRGAARVPVLGRARVANLSTAHPRFWPAVEAEPVEANGRGGI
251 LIHRDGRPATFMTVAATSRGIHQVMWVFNPAKIAAFLHSRTRHSSAPALC
301 V

>ECFp11058 ECF41 ECF41s10 Streptomyces neyagawaensis

1 MDEAAEVFQRLRSRLFGIAYRVLGSVSEAEDVVQEAWVRWQGADRAAVLD
51 PGAFLAKATTRLAINVAQSARVRREAYVGPWLPEPVDTSVDPQVGAERGE
101 AVELAVLLVLQKLNPVERAAYVLREAFDYPYDDIAGMLQVTQANTRQIVS
151 RARKRLSAERRDPVDTAEHRRLLEAFVAAARDGDVAALEGVLSADVVAYA
201 DGNGMRGVARLEVTGVGRVARISAFARKFFPGAEYDVVEANGRPSLRLVK
251 DGATVALVSATVGPDGIDGLYWILTPAKLRAYERSAHRVTGSRP

>ECFp11104 ECF41 ECF41s10 Micromonospora rifamycinica

1 MAAFLDVRPRLFGLAYRMLGSVVEAEDVVQEAWLRWQGTDRSVVRNPAAF
51 LTTTTTRLAVNAATSARATRETYVGPWLPEPVDTSADPTLGAERAAALDV
101 AVLLLLERLAPAERAAYVLHEAFDYPYREIAELLGTSEPNARQLASRARR
151 HLTVEGAAPAPPARRRQVAQAFLGAARDGDLATLERLLTADVVARADGGG
201 RVHAARRDVCGVARVTNFLDNVRRKYWRGTTIELAEVNGGPGLLVATDRP
251 VTLITLDTSVRGVERLLLVVNPDKLGRLPARR

Name Aliases LCA Taxa Group Subgroup
ECFp11588
  • RNA polymerase sigma24 factor
  • IH05_RS0123230
Allokutzneria albata ECF41 ECF41s10

>ECFp11588 ECF41 ECF41s10 Allokutzneria albata

1 MTRLDQAEAVFAEVRPRLFGLAYRMSGSVADAEDLVQEVWLRWQTADRAA
51 VVNPAAYLATAITRLAINESQTARARRETYVGPWLPEPVDTSADPQLGAE
101 RGAALELAVLALLEKLSPTERAAYVLREAFDYPYSQIAEIVRTTEVAARQ
151 LVSRARKRLAGERRARVEAAEQRRLLAAFVAAAQAGDLAGLERLFSDDVV
201 SYSDGGGKARAARVPLVGPRTLARVFAVWAPEFWSGAEVECVEANGLAAV
251 ALRREGKTFGLVTVTASGSGIDQVMWLVNPDKISSFDTT

Name Aliases LCA Taxa Group Subgroup
ECFp11677
  • RNA polymerase sigma24 factor
  • M504_RS13390
Terriglobus sp. TAA 43 ECF41 ECF41s10

>ECFp11677 ECF41 ECF41s10 Terriglobus sp. TAA 43

1 MEEELIPNVHDRGGHDDGLSAFAAVRPRLFGIAYRMLGSAAESEDILQDV
51 WMRWQTTNRNVVENPAAFLATITTRMCINLIQSASSRHETYTGTWLPEPV
101 DTSSDPTLGAEREEALQLAVLVLLEKLPATERAAYVLREAFDYSYREIAE
151 TLQIEEANARQLASRARKHIAEERRTAVNAKEQRRFLEAFINAAQRGDMA
201 TLENLFAEDVVSYSDGGGFVRAARVPVAGRERVAKFIAAFASHFWLGVTL
251 SWTHVNGRESILISCANEPIGLVATDASDQGIYEIMWVMRPSKLSRMQTK

Name Aliases LCA Taxa Group Subgroup
ECFp12016
  • ECF-family protein RNA polymerase sigma factor
  • RNA polymerase sigma24 factor
  • ... more
Saccharothrix espanaensis DSM 44229 ECF41 ECF41s10

>ECFp12016 ECF41 ECF41s10 Saccharothrix espanaensis DSM 44229

1 MSPTSWALLEDVSTMAETVGGDLDRATAVFAEVRPRLFGIAYRMLGSAAD
51 AEDLVQEVWLRWQAADRSAVRDPLAYLATATTRLAINAGRTARARHEVYA
101 GPWLPEPVDTSADPQLGAERDAALQVAVLFLLEKLTPTQRAAYVLREAFG
151 YSYAEIAEIVQATETSARQLVSRARRQLADGRRAPVTGSEQRRLLTAFVA
201 AARQGDLAALEELFAADVVSYSDGGGVVRASRIPVAGAATVAKYVRAFAG
251 HFWTGVEISWATVNGESAALLSRDGRVFTVLTVAVTADGIDRIFWMMNPD
301 KLAAVGRT

Name Aliases LCA Taxa Group Subgroup
ECFp12047
Herbidospora cretacea ECF41 ECF41s10

>ECFp12047 ECF41 ECF41s10 Herbidospora cretacea

1 MILVDSLENAASVFTELRPRLFGIAYRMLGSAAEAEDVVQDVWLRWQETD
51 RSAVQNPPAFLATIATRLSINVARSARARRESYIGPWLPEPVDTSADPTL
101 GAERGEALEFAFLLLLERLTPTERAAYVLREAFVYPYEQIAEIIQVTATN
151 ARQLVSRARKHLTAGRHEPIDKSEHRRLLEAFLDAAQSGDVVALEHLFAE
201 DVVSLTDGNGVRGAARLVMHGVPRVTKFVVSFAPRFWPGATVTFVDVNGR
251 PAVFVPAREKTGGALLVLDASPEGIHQLLWVMNPDKLSGYSK

Name Aliases LCA Taxa Group Subgroup
ECFp12057
Rhodococcus rhodnii ECF41 ECF41s10

>ECFp12057 ECF41 ECF41s10 Rhodococcus rhodnii

1 MELFSEVRPRLFGIAYRMLGSALDAEDLLQEVWLRWQNYDHDEVKNPAAF
51 LATVTTRLAINAGQTARARHETYVGPWLPEPVDTSADPQLGAERDAALQI
101 AVLVLLEKLTPTERAAYVLREAFDYPYPQIAEIIQVSEASARQLVSRARK
151 HLAAERRTPVSAAEQKRLLTAFVAAAKDGDMAKLEELLAADVVSYADSNG
201 TVRGASKVPVVGRLVVAKVIKAYSNTFWTGADITWAEVNGQPAAVLRRDG
251 HIYCVLSVTASDNGIDQLLWMMNPDKLAAFG

>ECFp12198 ECF41 ECF41s10 Streptomyces diastatochromogenes

1 MRARDDADSLDQATREFMAARPHLFGIAYRVLGSVVEAEDIVQDAWLRWQ
51 NTNRADIVEPTAFLATVTSRLAINLAQSAPKRRESYIGPWLPEPVDTRLD
101 PQLGAERAEALDMAVLHLMEKLNPVERAAYVLREAFDYPYKRIADMLETS
151 EANTRQLVSRARKRLSAERREPVSPAAHRRLLEVFLSAAQTGNLSVLEDV
201 LTADVVSYSDGGGIRGASKIPVVGRSHVSKYLAAFAPRFWPPTEVRWVEA
251 NGKPAVLVSADGNSVALLSVDVSERGIERIMWVMNPAKLAPYVASLDS

Name Aliases LCA Taxa Group Subgroup
ECFp12207
  • RNA polymerase sigma24 factor
  • H291_RS0118755
Promicromonospora sukumoe 327MFSha3.1 ECF41 ECF41s10

>ECFp12207 ECF41 ECF41s10 Promicromonospora sukumoe 327MFSha3.1

1 MTGDVDTTLDDAAEVFATARKRLFGIAYRMLGSAAEAEDVVQETWVRWQT
51 TDRSVVLNPQAFLTTAATRLAINVLQSARSRRETYIGPWLPEPVDTSDDP
101 TLGAERAEALDVAVLVLLEKLTPTERAAYVLREAFDYGYPEIAQIVGVSP
151 TATRQLVSRARKHLASERRNEVSPTARQDLLAAFLAAARVGDVARLEKLF
201 AEDVVTRADSNGRAKHVARVAVQGRNKVARVLSSFAEIFWAGITTRPVEV
251 NGTEGFAMERDGELVGVLSVVVSDQGLHELMWQMNPEKTEPLRRAWADQA
301 TPEAGAGEATPEPPATARS

>ECFp12410 ECF41 ECF41s10 Mycolicibacterium smegmatis

1 MDPAPSSASDPAWTELSEAEAVFTRVRPRLFGVAYRMTGTVAEAEDAVQE
51 AWLRWQDTDRAAVTDPVPFLMTVVTRICLNVLQSARARHETYIGPWLPEP
101 VDTTADPALGAERGAALELATLMLLERLAPPERAAYILREAFDYPYEQIA
151 ETVGVSVPNARQLVSRARRRLTTRRAAPVATAEQDRLLRAFVTAARSGDL
201 DALEEILAEDVVSHTDGNGVRNAAQIPVVGRTTVAKFVRAFRNRLWSGAS
251 LRWITANGRSAVLVVHNDSPAAFLTVAASADGIHRLLWVLAPEKLAGIAR
301 AQGR

Name Aliases LCA Taxa Group Subgroup
ECFp12549
Tsukamurella pulmonis ECF41 ECF41s10

>ECFp12549 ECF41 ECF41s10 Tsukamurella pulmonis

1 MTDHDAVFEALRPRLFGVAYRILASAPDAEDVVQDGWLRWRAAERDTVRD
51 PEAFLVVTVTRLALNAAQSARARREQYVGEWFPTPVDTAADPALGAERTE
101 ALELAVVHVLQRLAPEARAAYVLREAFDHPYARIAEILQMREPAVRKLVS
151 RARTQVAGERRTTATRARARALLDAFLAAAHAGDVAGLEAVLVADVVSET
201 DGGGARRAGRRPVVGGNAVARFVAGFSVRFMADTTARIVEVNGLPGAVFT
251 LDGAPVALLCPTASDDGLTRLMWVMNAEKLADFA

>ECFp12656 ECF41 ECF41s10 Microbacterium sp. Leaf288

1 MDPDDIRRAVTVFDEHRRRIFGIAYRMLGTVADAEDIVQETWIRWQNADR
51 AEVREPGAFLATVATRLSINATQSAHARRETYIGPWLPEPVNTDADPALG
101 AERGEALQYAILLVLEKLTPTERAAYILREALDYPYERIADVIGATVASA
151 RQLVSRARKHLESARKAEVAAAEQRRLLEAFLVAAQKGDVSDLERLFAED
201 VVSYTDGNGVKLAARIPVAGRSRVAQFVAAFSSHFWTGKQIDWVEVNGRP
251 AATLSEGGEVTTLVTVTAAEDGIRRLLWVMSPEKLGHVAQVGA

>ECFp12439 ECF41 ECF41s10 Actinobacteria

1 MAQEAGLAEFEQVRPRLFGIAYRMMGTASDADDVVQDTWLRWSRTDRSAV
51 RDPGAFLATTATRLAINALTSARATRETYVGPWLPEPVSTTDDPALGAER
101 AEALEMAVVRLLERLAPKERAAYILREAFDYPHRDIAELLDTSEANARQL
151 VRRARDHIAVERAVPADPDEQAQILGAFLTAAQSGDLAALESVLTAQVTA
201 VSDGGGVVSAARVPIIGRAKVARFVLGTLEKFAAGAYSTLVEVNGSPAVL
251 TIRDGRPDTVLSFDIGADGINTLLFVRNPDKLHAVAALSSSISPDEAVRW

>ECFp12689 ECF41 ECF41s10 Streptomyces sp. WM6386

1 MYVEPSLSTPDDLEDAVAVFVHHRRRLFGIAYRILGSAVEAEDVVQEVWL
51 RWQKTDRSVVLSPAAFLSSATTRLAINVAQSARVRRETYVGPWLPEPVDT
101 SADPAVGAEHAEAVELALLLVLEKLTPVERAAYVLREAFDYAYAEIADML
151 ELSLVNVRKIVSRARRHLLDERRETVDAAEHRRLLDTFVSAARTGDVASL
201 EALLAPDVVSLSDGNGMRGCARVPVRGRARVARLSTYRQLWQEAVPELVD
251 ANGATGVLVHRDGRTVAFMTAAASKHGIHQVLWVFAPSKIAAFVASRSRF
301 AATPDLT

>ECFp12782 ECF41 ECF41s10 Amycolatopsis rifamycinica

1 MGAELGGVDGLEAATAVFTRLRPRLFGIAYRMLSSVTEAEDLVQEVWLRW
51 QTYDRSAVANPEAFLATTTTRLAINVLQSARNRRETYIGPWLPEPVDTGA
101 DPYLGAERGEALEFATLLLMEKLTPNERAAYVLREAFDYSYARIADILSS
151 TEPAVRQLASRARKHIAGGRGAPVAAAAQRELLTAFLAAARSGNVAALER
201 LFTPDVTSLSDGNGRKGVARTPVVGAARVAKFLQAISTWFWDDVDVRWAV
251 TNGQASAVLLQDGGVYGLLTVGATTEGVDHVLWLVNPEKNNAVSVAG

Name Aliases LCA Taxa Group Subgroup
ECFp12803
  • hypothetical protein
  • G004_RS0120505
Acidobacteriaceae bacterium KBS 96 ECF41 ECF41s10

>ECFp12803 ECF41 ECF41s10 Acidobacteriaceae bacterium KBS 96

1 MEPKAQGDALSQFVKVRPRLFGIAYRILGSAAEAEDIVQDVWLRWQGANR
51 SAVLDPPAFPAAATTRLAINLAQSARSRRETYVGPWLPEPVDTSADPQLG
101 AERGEALEFAVLLLLEKLSPTERAAYVLREAFDYPYRQIAEILQLEEANT
151 RQLVTRARQHITDGRRAPVSSAEQRRLLEAFIAAAQKGDLAALETLFASD
201 VVSYSDGGGVVNAARAPIAGRERVAKFITAFASHFWTGVTLTSIQTNGQS
251 SVLISRDGAVVTVATIDASAEGIGQILWMMRPSKLNAIAKSYETRINRDL
301 QTP

Name Aliases LCA Taxa Group Subgroup
ECFp12864
  • RNA polymerase sigma24 factor
  • BF93_00870
Brachybacterium phenoliresistens ECF41 ECF41s10

>ECFp12864 ECF41 ECF41s10 Brachybacterium phenoliresistens

1 MGEDGDLGTAAAVFAAQRRRLFGIAYRMLGTAADAEDILQETWIRWQGAD
51 RTQVQDPPAFLATITTRLAITQLQSARVRRETYIGPWLPEPVSTQDDPAL
101 GAERGEALDLALLLTLERLTPTERAAYILREAFDYPYARIAEIISSSAVN
151 ARQLVRRARAHLTSGRPASVAPAQQRRLLDAFLAAARRGDVQELEGLLAR
201 DVASRTDGNGVKLAARIPVHGRARVARFVAAFSHHFWTGKTIGWITVNGQ
251 AAATLSEGGRVTTLVTVTASEEGIAQIHWVMSPEKLGHVNAATQLTAPGD
301 STRRTDRTDPADPVEPAQPVEPADASEGPVPPGNPGAAAGGPG

Name Aliases LCA Taxa Group Subgroup
ECFp10657
Rhodococcus sp. JVH1 ECF41 ECF41s10

>ECFp10657 ECF41 ECF41s10 Rhodococcus sp. JVH1

1 MDAKLDTQTQTPIQDTSEGADVYTGDGGREISDLDQAASAFLNLRPRLFG
51 IAYRILGSASEAEDIVQEVWLRWQGTDRTVVINPSAFLATTTTRLAITLA
101 QSARKRHETYDLPSLPEPVDPHNDPAAEAELCEEVQSAMLILQELTPTER
151 AAYVLREAFDYPYRKISEILHLGVANTRQLVKRARNRIAARREHRGVMNV
201 VAHRRLVRAFFSAAQAGNFADLEELLAKDVVDPSRPGIESRKPISSMTDR
251 EFWRHVQQDTDDELQADIDNPARTPEQHDALVHALLARKDAHDAAERLAD
301 NRERWPWVRPNYFDTDSDFATAAVV

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more