ECF proteins of ECF subgroup ECF38s2

Displaying ECF 161 - 180 of 393 in total
Name Aliases LCA Taxa Group Subgroup
ECFp26492
Streptomyces sp. SS ECF38 ECF38s2

>ECFp26492 ECF38 ECF38s2 Streptomyces sp. SS

1 MGATDADTDDSATEFRAFFERHYAELARLAHLLTGETDAADDLAADAMLA
51 LWHRWDRVRAADHPAAYARGVVANLVRTRIRGTVRERRRVAAFWDRRPEH
101 TEDPDVPAVVDVRTALRALPFRKRACVVLRHAFDLSERDTALALGVSVGT
151 VKSQTAKGMAELQRLLGPRAATELTAGRQ

Name Aliases LCA Taxa Group Subgroup
ECFp26506
  • RNA polymerase subunit sigma
  • ASE03_22995
  • ... more
Kitasatospora ECF38 ECF38s2

>ECFp26506 ECF38 ECF38s2 Kitasatospora

1 MLLDDASAEFHDFFERHYAELARLAHLLTGETDAADDLAADALLALWQRW
51 DRLRTADHPLAYARGVVANMARERIRSAVRERRRVALFWSRHPERVDGPN
101 VAAVLDVRTALARLPYRKRACVVLRHAFDLPEKDTAVALGISVGTVKSQT
151 SKGMAELERLLGARAAGALVAGRRTR

>ECFp26511 ECF38 ECF38s2 Streptomyces canus 299MFChir4.1

1 MLLDDASAEFHEFFERHYAELARLAHLLTGETDAADDLAADALVALWQRW
51 DRLRQADHPLAYARGVVANLARGRVRSAVRERRRIALFWSRGPERVEGPD
101 MAAVLDVRAALARLPFRKRACVVLRHAFDLSEKDTAVALGISVGTVKSQT
151 SKGMAELVKILGAGAAGDLVAGRRNR

>ECFp26513 ECF38 ECF38s2 Streptomyces mirabilis

1 MVLDDASAEFHEFFERHYAELARLAYLLTGESDAADDLAADALVALWQRW
51 DRLRQADHPLAYARGVVANLARGRIRSTVRERRRITLFWSRSPEKVDGPD
101 TAAVLDVRAALARLPYRKRACVVLRHALDLSEKETAAALGISVGTVKSQT
151 SKGMAELEKLLGAHAAGDLVPGRRTNR

>ECFp26510 ECF38 ECF38s2 Streptomyces griseorubiginosus

1 MGTVVDDDASVEFHAFFERHYAELSRLAHLLTGESDAADDLAADALLALW
51 QRWDRVRAAEHPAAYARGVVANLARTRIRGTVRERRRIALFWSQRAEKVE
101 NPDVAGVVDVREALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGIQDAPLRMRAAMARTGETGGRDR

Name Aliases LCA Taxa Group Subgroup
ECFp26521
  • RNA polymerase sigma factor
  • IF04_RS0127990
Streptomyces violens ECF38 ECF38s2

>ECFp26521 ECF38 ECF38s2 Streptomyces violens

1 MAGRTDAAAEFRAFFECHYAELARLARLLTGDAEGADDLAADALVALWRR
51 WDRVRAADHPAAYARGVVANLARSHIRSAIRERRRITLFWAQCSDHAEAP
101 DVPAVVDVQQALRTLPFRKRACVVLRHAFDLSERETALALGISVGTVKSQ
151 TSKGMAQLERLLGPQATVLVPLRN

>ECFp26512 ECF38 ECF38s2 Streptomyces sp. CCM_MD2014

1 MGTVVDDAASAEFHAFFERHYAELARLARLLTGEPDAADDLAADALLALW
51 HRWDRVRTADHPVAYARGVVANLARTRVRTAVRERRRVALFWSQREERTE
101 NPDVAGVVDVQEALRRLPFRKRACVVLRHAFDLSERDTALALGVSVGTVK
151 SQTSKAVAELQRLLGTRAAPRAPRQVHAAIARSGGAAGGAR

Name Aliases LCA Taxa Group Subgroup
ECFp26519
  • RNA polymerase subunit sigma
  • NH08_RS0112840
Streptomycetaceae ECF38 ECF38s2

>ECFp26519 ECF38 ECF38s2 Streptomycetaceae

1 MTPPTLPMSMNTPRSAAPAGPAPATGDASAEFHAFFERHHAELARLAHLL
51 TGEADAADDLAADALLALWHRWDRVRGAEHPVAYARGVVANMARGRIRST
101 VRERRRIALFWSQRSERTDGPDVAAVVDVRQALERLPFRKRACVVLRHAF
151 DLSERDTALALGISVGTVKSQTSRGMAELQRHLGTGAADDLSGRGK

>ECFp26520 ECF38 ECF38s2 Streptomyces

1 MGTVVDDAASVEFHAFFERHYAELSRLAHLLTGEPDTADDLAADALLALW
51 HRWDRVRAADHPAAYARGVVANLARTRIRSAVRERRRIALFWSQREENTE
101 NPDIAGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGTQGVPQRMHAALVAPRRSPAVEGVRTGEGGGRDR

>ECFp26527 ECF38 ECF38s2 Streptomyces xanthophaeus

1 MTEDEAAADFHAFFERHHAELSRLAYLLTGDADAADDLAADAMVALWHRW
51 DRARRADSAAAYARGVVANLARSRIRSTVRERRRVLLFWAHRPERTDGPD
101 LAAVMDVRAALDRLPFRKRACVVLRYAFDLSEKDTAQALGISVGTVKSQT
151 SKGTAELQRLLGGRAADELAGRGSR

>ECFp26542 ECF38 ECF38s2 Actinobacteria bacterium OV450

1 MVLDDASAQFHEFFERHYAELARFAHLLTGEADGADDLAADALIALWQRW
51 DRLGQVEYPLAYARGVVANLARSRIRSAVRERRRIALFWSRGVEPSGGPD
101 VAAVVDVRTALARLPFRKRTCVVLRHAFDLSEKDTALTLGISVGTVKSQT
151 SKGMAELERMLGGTEAAGELLAGRRSR

Name Aliases LCA Taxa Group Subgroup
ECFp26546
  • RNA polymerase sigma factor
  • IE98_RS0140125
Streptomyces sp. NRRL B-24484 ECF38 ECF38s2

>ECFp26546 ECF38 ECF38s2 Streptomyces sp. NRRL B-24484

1 MTADDASAEFHDFFERHHAELARLAHLLTGEADAADDLAADAMVALWHRW
51 ERVRGADHPAAYARGVVANLARGRIRSAVRERRRVLLFWSQRTERTDGPD
101 VASVLDVRAALARLPFRKRACVVLRHAMDLSEKETALALGVSVGTVKSQT
151 SKGMAELQRLLGDRAGELTGRRS

Name Aliases LCA Taxa Group Subgroup
ECFp26541
  • RNA polymerase sigma factor
  • OP79_RS00485
Streptomyces yerevanensis ECF38 ECF38s2

>ECFp26541 ECF38 ECF38s2 Streptomyces yerevanensis

1 MGTVVDDAASVEFHDFFERHYAELARLAHLLTGESDAADDLAADALLAMW
51 HRWDRVRAADHPVAYARGVVANLARSRIRSAVRERRRITLFWSQREESSE
101 NPDVPAVVDVQGALRSLPFRKRACVVLRHAFDLSEKDTALALGISVGTVK
151 SQTSKGMAELQRLLGSADGPSHVHAAVLRTGGTGGGNS

>ECFp26543 ECF38 ECF38s2 Streptomyces aurantiacus JA 4570

1 MPPQTAAGDAATEFHAFFERHYAELSRLAHLLTGEYDGADDLAADALLAL
51 WHRWDRVRAAEHPAAYARGVVANMARSHIRSTVRERRRITLFWSNRGDET
101 LDPDVPAVIDVQEALRGLPFRKRACVVLRHAFDLSEKDTANALGISVGTV
151 KSQTSKGMAELQRRLGPHATPARMHAAVQAPGGTA

>ECFp26544 ECF38 ECF38s2 Streptomyces

1 MGTVVDDTAAVEFHAFFERHYAELSRLAHLLTGEADIADDLAADALLALW
51 HRWDRVRAADHPAAYARGVVANLARTRIRGAVRERRRIALFWSPREERIE
101 NPDVPGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGTREMPRQVHAAVAATAGGEAVGNARKRPHGARGRK
201 R

>ECFp26548 ECF38 ECF38s2 Streptomyces albus subsp. albus

1 MNTPRSAAPAGPAPATGDASAEFHAFFERHHAELARLAQLLTGEADAADD
51 LAADALLALWHRWDRVRGAEHPVAYARGVVANMARGRIRSTVRERRRIAL
101 FWSQRSERTDGPDVAAVVDVRQALERLPFRKRACVVLRHAFDLSERDTAL
151 ALGISVGTVKSQTSRGMAELQRHLGTGAADDLSGRGK

Name Aliases LCA Taxa Group Subgroup
ECFp26555
Rhodococcus rhodnii ECF38 ECF38s2

>ECFp26555 ECF38 ECF38s2 Rhodococcus rhodnii

1 MLLDDASAEFHDFFEQHYAELARLAYLLTGETDAADDVAADALIALWQHW
51 DRLRRAQHPLAYARGVVANLARERIRSATRERRRIALFWSRGPQQAQGPD
101 VAAVVDVRAALDRLPFRKRACVVLRHAFDLSEKDTALALGISVGAVKSQT
151 SKGLAELERLLGVRAAGDMVAGRRSR

Name Aliases LCA Taxa Group Subgroup
ECFp26562
Frankia sp. ACN1ag ECF38 ECF38s2

>ECFp26562 ECF38 ECF38s2 Frankia sp. ACN1ag

1 MPVEAVAADDEHEHPHRQAEFHAFFESHHRALSRFAYLLTGDHDAADDLT
51 AEALTAAWSSWDRVRSAELPLAYVRRIVANLAADRVRKVVRERRGLAVLG
101 QRAERSAPVPDVPAVVDLRTALMSLPSGKRACVVLRYAFDLSEGETARTL
151 GISVGTVKSQTAKGVAELERILKRAEPPPTATTQEEVTPRMAPEHPETPQ
201 GGTSRPGTSRMNGARSGSGDSPGGRGAGQSDEPAGPDRSAFAPPRGTEPT
251 PGTGLTRGTGLTAAPDLTPGADLTPGAGPTPGSGRHPHGEPFPETGRLPG
301 PVPLARREPLRREPVPWRGSASGRQPLSRHERVPGPERVPGPERVPGPER
351 VPGPERVPGPERLSPTERMPQAERMPPTEHVARLDEPGWLERPRGADSPT
401 WPESLPWLRLAWPERLAWPVWRVGEA

>ECFp26569 ECF38 ECF38s2 Streptomyces

1 MLLDDASAEFHDFFERHYAELARLAHLLTGETDAADDLAADALIALWQRW
51 DRLRAADNPIAYARGVVANMARARIRSAIRERRRVLLFWSRAPERTDGPD
101 TAAVLDVRTALARMPFRKRACVVMRHAFDLSEKDTAAALGISVGTVKSQT
151 SKGMAELKRALGAQAVGELTAGRRNR

>ECFp26552 ECF38 ECF38s2 Streptomyces sp. NRRL F-2580

1 MATVVDDAASVEFHAFFERHHAELARLAHLLTGEADAADDLAADALLALW
51 HRWDRMRASEQPVAYARGVVANLARMRIRSAVRERRRVALFWAQREEKTE
101 NPDVAGMVDVQGALRRLPFRKRACVVLRHAFDLSEKDTAMALGVSVGTVK
151 SQTSKGMAELQRLLGTQDAPRKVHAAMARTGNAGGWDR

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more