ECF proteins of ECF subgroup ECF38s2

Displaying ECF 141 - 160 of 393 in total

>ECFp26426 ECF38 ECF38s2 Streptomyces sp. AW19M42

1 MGTSIDADDAAAEFHAFFEAHYAELARFAHLLTGEADAADDLAADALLAL
51 WHRWDRVRNADHPAAYARGVVANLARTRIRSAVRERRRIALFWAPRGGGD
101 GYAVEDPDVSAVVDVQGALRRLPFRKRACVVLRHAFDLSERDTSLVLGIS
151 VGTVKSQTSRAVAELQRLLGPDTPAAHVHVAVAAQRTGTGTEGGQ

Name Aliases LCA Taxa Group Subgroup
ECFp26428
  • RNA polymerase subunit sigma-24
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Streptomyces violaceusniger Tu 4113 ECF38 ECF38s2

>ECFp26428 ECF38 ECF38s2 Streptomyces violaceusniger Tu 4113

1 MNAPADDAAAAGTARAPGAPEDPDGLSADARTRPHTGSQANAHTGPQPTP
51 HPADPQAEFRDFFERHHAELARLAHLLLGSSDGADDLAADALVAVWHQWD
101 RVRAADHPAAYARGVVANLARSRIRSLVRERRRVALFSSQRSDRVDDPDV
151 SAVVDVQAALVRLPFRKRACVVLRHAFDLSERETARTLGISVGTVKSQTS
201 RGIAELERLLGPPDGEGELPGATEAEQTVRTLHSGNTGHTGHTGPARHSG
251 HMGHAGHAGGGS

>ECFp26433 ECF38 ECF38s2 Streptomyces rapamycinicus NRRL 5491

1 MHPADALPPADALPADPQAEFRDFFERHHAELARLAHLLLGSSDGADDLA
51 ADALVAVWHQWDRVRAADHPAAYARGVVANLARSRIRSLVRERRRVALFS
101 SQRPDRVDDPDVSAVVDVQAALVRLPFRKRACVVLRHAFDLSERETARTL
151 GISVGTVKSQTSRGIAELERLLGPPDGGDEEELSAATEADRTGRTGRTVR
201 TLRAGSTGSTGHTGHTSHTGHTGPARHSGHMGHAGHAGGGS

>ECFp26456 ECF38 ECF38s2 Nocardioidaceae bacterium Broad-1

1 MLADDASTEFHDFFERHYAELARLAHLLTGEKDAADDLAADALVALWQRW
51 DRLRAAQHPVAYARGVVANLARERIRSSVRERRRVALFWSLGAEHVNGPD
101 VAVVQDVRAALTRLPFRKRACVVMRHALDLSEKDTAAALGISVGTVKSQT
151 SKGMAELERLLGADTAGELATGGRNR

Name Aliases LCA Taxa Group Subgroup
ECFp26439
Streptomyces canus ECF38 ECF38s2

>ECFp26439 ECF38 ECF38s2 Streptomyces canus

1 MRTAADDDASAEFHAFFERHYAELARLAHLLTGEPDAADDLAADALLALW
51 HRWDRVRAADHPVAYARGVVANLARTRVRTAVRERRRVTLFWSQRAERAE
101 NPDVAGVVDVREALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGVAELQRLLGTRSAPPAPRQVRAAIARSGEAAGGTR

>ECFp26447 ECF38 ECF38s2 Kitasatospora aureofaciens

1 MRTAVDAAASAEFHAFFERHYAELARLAHLLTGEPDAADDLAADALLALW
51 HRWDRVRAADHPVAYARGVVANLARTRVRTAVRERRRVALFWSQREERSE
101 NPDVAGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGVAELQRVLGTRAAPRAPRQVRAAIARSGGATGGTR

>ECFp26450 ECF38 ECF38s2 Actinosporangium sp. NRRL B-3428

1 MRGHRNRDVAASEPDAAAEFHRFFEQHHASLSRLAFLLTGDADGADDLTA
51 DALLALWHRWDRVRAAEHPAAYARGVVANMARSHIRSAVRERRRITLFWA
101 GHGERSDGPDVAAVVDVQEALRRLPFRKRACVVLRHALDLSEREVAETLG
151 VSVGTVKSQTSKGMAELHRTLGPQPALHRMRMSVADAGGRH

>ECFp26440 ECF38 ECF38s2 Streptomyces stelliscabiei

1 MGTVVDDAASVEFHAFFERHYAELSRLAHLLTGEADAADDLAADALLAMW
51 HRWDRVRAADHPVAYARGVVANLARTRIRSAVRERRRITLFWSQREEKTE
101 NPDVPGVVDVQSALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQKLLGTENAPRRMHAGITGGGVRGASVTGAGAPGSGGRDR

>ECFp26463 ECF38 ECF38s2 Streptomyces rimosus subsp. rimosus

1 MNTSRSAAATGPAPATGDASAEFHAFFERHHAELARLAHLLTGEADAADD
51 LAADALLALWHRWDRVRGAEHPVAYARGVVANMARGRIRSTVRERRRIAL
101 FWSQRSERADGPDVAAVVDVRQALERLPFRKRACVVLRHAFDLSERDTAL
151 ALGISVGTVKSQTSRGMAELQRHLGMGAADDLSGRGK

Name Aliases LCA Taxa Group Subgroup
ECFp26437
  • RNA polymerase subunit sigma
  • H613_RS24890
Glycomyces arizonensis DSM 44726 ECF38 ECF38s2

>ECFp26437 ECF38 ECF38s2 Glycomyces arizonensis DSM 44726

1 MDVPAPQGEAAFRVFFEQHHAELARFAWLLLGEKAAAEDLAADAMLAVWK
51 QWNRVERSASGIAYARGIVANLAKTRIRSAVRERRRNAMFWLRPGESVSE
101 PNVAAVVDVRRALARLPFRKRACVVLRHSLGLSELETAEALGVSVGTVKS
151 QTSKGLAELRKILGPPSGGQNGSSWDSIPNGVGR

Name Aliases LCA Taxa Group Subgroup
ECFp26458
  • RNA polymerase subunit sigma-24
  • SIRAN_RS35750
Streptomyces iranensis ECF38 ECF38s2

>ECFp26458 ECF38 ECF38s2 Streptomyces iranensis

1 MSAPADDAAASGTARAVRMDAARMTDAPRDPGGPGHVSPQAPDAPEGPDG
51 LPAEALPVNALPADALPADPQAEFRDFFERHHAELARLAHLLLGSSDGAD
101 DLAADALVAVWHQWDRVRAADHPAAYARGVVANLARSRIRSLVRERRRVA
151 LFSSQRPDRVDDPDVSAVVDVQAALVRLPFRKRACVVLRHAFDLSERETA
201 RTLGISVGTVKSQTSRGIAELERLLGPPDGEDEEEPSAAAEAERTGRTVR
251 TLRAGNTGHTGHTGHTSRTGPARHSGHMGHAGHAGGGS

>ECFp26483 ECF38 ECF38s2 Streptacidiphilus jeojiense

1 MAFGTTTPRNATTDAAFHAFFEERHRELSRLAYLLTGEADAADDLAADAL
51 LEVWRHWERVSAADSPAAYARGVVANLCRNRIRKLTRERAGLRGWGTLWR
101 DRESVSGTDVPAVVDVRGALRRLPHRRRACVVLRYAFDLSERETAAALGI
151 SVGTVKSQTSRGAAQLAELLAGRPEAQWLVAAGEEG

Name Aliases LCA Taxa Group Subgroup
ECFp26494
Streptomyces anulatus ECF38 ECF38s2

>ECFp26494 ECF38 ECF38s2 Streptomyces anulatus

1 MADDASAQFHEFFDRHYAELSRLAFLLTGEADAADDLAADAFVALWDRWD
51 RMSAAEHPVAYARGVVANLARSRIRGAVRERRRIALFWSRRAERTDGPDV
101 AAVLDVRQALRRLPFRKRACVVLRHALDLSERDTALALGISVGTVKSQTS
151 KGMAELERLLGDRTGLETVGSGRR

>ECFp26474 ECF38 ECF38s2 Streptomyces sp. 351MFTsu5.1

1 MLLDDASVEFHEFFERHYAELARLAHLLTGETDAADDLAADALVALWQHW
51 DRLRGADHPLAYARGVVANMARGRIRSAVRERRRITLFWSRSPEKVEGPD
101 TAAVLDVRAALARLPYRKRACVVLRHALDLSEKETAAALGISVGTVKSQT
151 SKGMAELQKLLGAHAAGDLVPGRRNR

Name Aliases LCA Taxa Group Subgroup
ECFp26477
  • RNA polymerase sigma factor
  • IF47_RS0102345
Streptomyces megasporus ECF38 ECF38s2

>ECFp26477 ECF38 ECF38s2 Streptomyces megasporus

1 MVLDDASAEFHEFFERHHAELARLAHMLTGETDAADDLAADALLELWHHW
51 DRVRRADHPVAYARGVVANLARVRVRGAVRERRRLALFRLPWSERVHDPD
101 VAAVMDVRTALARLPFRKRACVVLRHAFDLSEKDTALALGISVGTVKSQT
151 SKGVAELRRMLGPRAADELTGRRR

Name Aliases LCA Taxa Group Subgroup
ECFp26465
  • RNA polymerase sigma factor
  • RNA Polymerase Sigma-24 Subunit ECF Subfamily
  • ... more
Streptomyces leeuwenhoekii ECF38 ECF38s2

>ECFp26465 ECF38 ECF38s2 Streptomyces leeuwenhoekii

1 MGTVVDDAASVEFHAFFERHYAELSRLAHLLTGEPDAADDLAADALLALW
51 HRWDRVRAADHPVAYARGVVTNLARTRVRSAVRERRRIALFWSQREERTE
101 NPDVAGVIDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKAMAELQRLLGTRHVPQQVHVAMARTGEAGGRNR

>ECFp26466 ECF38 ECF38s2 Streptomyces canus 299MFChir4.1

1 MGTVVDDAASVEFHAFFERHYAELSRLAHLLTGEPDAADDLAADALLALW
51 HRWDRVRAAEHPAAYARGVVANLARTRIRSAVRERRRVALFWSQREEKVE
101 NPDVAGVVDVQEALRRLPFRKRACVVLRHAFDLSEKETALALGVSVGTVK
151 SQTSKGMAELQRLLGPQNAPLKVRATMARTGDAGGRDR

>ECFp26468 ECF38 ECF38s2 Streptomyces ambofaciens

1 MGTVVDDAASVEFHAFFERHYAELSRLAHLLTGEPDAADDLAADALLALW
51 HRWDRVRAADHPVAYARGVVANLARTRIRTAVRERRRVALFWSQREERTE
101 NPDVAGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGVAELQRLLGMQAAPGQVHAAFARSGGAVGRDR

>ECFp26469 ECF38 ECF38s2 Streptomyces sp. NRRL S-1824

1 MGTVVDDAAAAEFHEFFEAHYAELSRLAHLLTGEADAADDLAADALLALW
51 HRWDRVRNADHPVAYARGVVANLARTRIRSAVRERRRIALFWAPRGGGYA
101 VDDPDVSTIVDVQGALRRLPFRKRACVVLRHAFDLSERDTSLVLGISVGT
151 VKSQTSRAVAELQRLLGPDTPAAQVQVAVAAQRDGGRH

>ECFp26473 ECF38 ECF38s2 Streptomyces

1 MGTVVDDDAAVEFHAFFERHYAELSRLAHLLTGEADAADDLAADALLALW
51 HRWDRVRAADHPAAYARGVVANLARTRIRSAVRERRRVALFWSQREEKAE
101 NPDVAGVVDVQEALRGLPFRKRACVVLRHAFDLSEKDTALALGISVGTVK
151 SQTSKGMAELQRLLGTRQAPLRVHAAALGAAPRPLAVESLGDRAGDARGR
201 NR

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more