ECF proteins of ECF subgroup ECF38s2

Displaying ECF 101 - 120 of 393 in total
Name Aliases LCA Taxa Group Subgroup
ECFp176704
  • RNA polymerase subunit sigma
  • AMK09_15200
Streptomyces sp. CB02488 ECF38 ECF38s2

>ECFp176704 ECF38 ECF38s2 Streptomyces sp. CB02488

1 MGTSIDADGAAAEFHEFFEAHYAELARLAHLLTGEADAADDLAADALLAL
51 WHRWDRVRSADHPVAYARGVVANLARTRIRSAVRERRRIALFWAPRGGGD
101 GYAVEDPDVSAMVDVQGALRRLPFRKRACVVLRHAFDLSERDTSLVLGIS
151 VGTVKSQTSRAVAELQRLLGPDTPAAHVHVAVAAQRTGGGQ

>ECFp176714 ECF38 ECF38s2 Streptomyces sp. CB03234

1 MRRTSADGDAAAEFHDFFERHYAELARLAHLLTGEADAADDLAADALLAL
51 WHRWDRVRAAEHPAAYARGVVANLARSRIRSAVRERRRIALFWSQHATHT
101 DDPDIPSVVDVQGALRTLPFRKRACVVLRHAFDLSERDTALSLGISVGTV
151 KSQTSKAMAQLERLLGGRAATHLMGKTWTS

>ECFp176718 ECF38 ECF38s2 Streptomyces autolyticus

1 MSAPTDDAAAASTARAVPMDTTHTTDPPRAAAPEAPDAPEGPDGLSADAH
51 PDLPADLPADSPATGHPDPPAAPHADLQTAAPHPDPPDPQAEFRDFFERH
101 HTELARLAHLLLGSSDGADDLAADALVAVWHQWDRVRAADHPAAYARGVV
151 ANLARSRIRSLVRERRRVALFSSQRSDHVDDPDVSAVVDVQAALVRLPFR
201 KRACVVLRHAFDLSERETARTLGISVGTVKSQTSRGIAELERLLGPPDGE
251 GELPGATDAGRTVRTLRSGNTGPTGTGPTGTGPAGPARHSGQMGHAGHAG
301 GGS

>ECFp176728 ECF38 ECF38s2 Streptomyces sp. IMTB 2501

1 MVLDDASAEFHEFFERHYAELARLAHLLTGETDTADDLAADALVALWQRW
51 DRLRQADHPLAYARGVVANLARGRIRSAVRERRRITLFWSRSPQKVEGPD
101 VAAVLDVRAALARLPFRKRACVVLRHAFDLSEKDTAVALGISVGTVKSQT
151 SKGMAELERILGARAAGDLVAGRRNR

>ECFp176724 ECF38 ECF38s2 Streptomyces sp. cf386

1 MGTVVDDAASVEFHAFFDRHYAELSRLAHLLTGEADAADDLAADALLALW
51 HRWDRVRAADHPVAYARGVVANLARTRIRSAVRERRRIALFWSQREEKTE
101 NPDVAGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGISVGTVK
151 SQTSKGMAELQRLLGTQGAPLRVHAAAMARTGNAGGRNR

>ECFp176727 ECF38 ECF38s2 Streptomyces sp. MJM1172

1 MATTVDDAASVEFHAFFERHHAELARLAHLLTGEADAADDLAADALLALW
51 HRWDRVRASGQPVAYARGVVANLARARIRSAVRERRRVALFWAQREEKTE
101 NPDVAGVVDVRGALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGTQDAPRKVHAAMARTGTAEGRDR

>ECFp176738 ECF38 ECF38s2 Streptomyces sp. TLI_105

1 MITADAGAEDSATEFRAFFERHYAELARLAHLLTGETDAADDVAADAMLA
51 LWNRWDRVRAADHPAAYARGVVANLVRTRIRGTVRERRRIAAFWDRRPEH
101 TEDPDVPAVVDVRTALRALPFRKRACVVLRHAFDLSERDTALALGVSVGT
151 VKSQTAKGMAELQRLLGDRAATELAAGRR

>ECFp176759 ECF38 ECF38s2 Streptomyces sp. CB00455

1 MLVDDTSAEFHEFFERHYTELARLAYLLTGETDAADDLAADALIALWQRW
51 DRLRAADHPLAYARGVVANMARERIRSAVRERRRIALFWSRDPEKTDGPD
101 VAAVLDVRAALARLPFRKRACVVLRHAFDLSEKDTARALGISVGTVKSQT
151 SKGMAELERVLDAREVGELVTGRRNR

>ECFp176754 ECF38 ECF38s2 Streptomyces sp. 3213.3

1 MGTVDDAASVEFHAFFERHYAELSRLAHLLTGEADAADDLAADALLALWH
51 RWDRVRAADHPAAYARGVVANLARTRIRSAVRERRRVALFWSQREEKTEN
101 PDVAGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVKS
151 QTSKGMAELQRILGSQSPPLRMHAAMARGGETGRRNR

>ECFp176755 ECF38 ECF38s2 Streptomyces sp. CB02261

1 MATADTETGDSAAEFRAFFERHYAELARLAHLLTGETDAADDLAADAMLA
51 LWHRWDRVRAADHPAAYARGVVANLVRTRIRGTVRERRRIAAFWDRRPDH
101 TEDPDVPAVLDVRAALRALPFRKRACVVLRHAFDLSERDTALALGVSVGT
151 VKSQTAKGMAELQRSLGPRAASELAAGRR

>ECFp26350 ECF38 ECF38s2 Streptomyces

1 MTDTGGDDAAAEFRAFFERHYTELARLAHLLTGETDAADDLAADAMLALW
51 HRWDRVRAADHPAAYARGVVANLVRTRIRSTVRERRRITAFWDRRPEHTE
101 DPDVPAVLDVRTALRALPFRKRACVVLRHAFDLSERDTALALGVSVGTVK
151 SQTAKGMAELQRLLGDRAATELTAGRR

>ECFp26340 ECF38 ECF38s2 Streptomyces fulvoviolaceus

1 MGTVVDDAASVEFHAFFERHYAELSRLAHLLTGESDAADDLAADALLALW
51 HRWDRVRAADHPAAYARGVVANLARTRIRSAVRERRRIALFWSQREEKTE
101 NPDVAGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGVTVGTVK
151 SQTSKGMAELQRLLGTQEAPLKVHAAMARTSEAGGRNR

>ECFp26346 ECF38 ECF38s2 Streptomyces sp. NBRC 110468

1 MGTVVDDAASVEFHAFFDRHYAELSRLAHLLTGEADAADDLAADALLALW
51 NRWDRVRAADHPVAYARGVVANLARTRIRSAVRERRRIALFWSQREEKTE
101 NPDIAGAVDVRSALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQKLLGAKGVPLTMPAMVRTGEASASGRDR

Name Aliases LCA Taxa Group Subgroup
ECFp26347
  • RNA polymerase sigma factor
  • SPRI_0879
  • ... more
Streptomyces pristinaespiralis ECF38 ECF38s2

>ECFp26347 ECF38 ECF38s2 Streptomyces pristinaespiralis

1 MATATDDARVEFQAFFERHYAELARLAHLLTGEADAADDLAADAMLALWD
51 RWDRARAADHPVAYARGVVANLARSRIRSAVRERRRVALFWSQRSEKADG
101 PDVPVVVDVREALRALPFRKRACVVLRHAFDLSERDTALALGVSVGTVKS
151 QTSKGMAELQRLLGPMAASELVGGRN

>ECFp26348 ECF38 ECF38s2 Streptomyces sp. NRRL S-646

1 MGTVVDDAASVEFHAFFERHYAELSRLAHLLTGEADAADDLAADALLALW
51 HRWDRVRAADHPAAYARGVVANLARTRIRSAVRERRRISLFWSQREEKTE
101 NPDIAGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQKILGSQGVPKKVHAAMARGGDSGGTDR

>ECFp26349 ECF38 ECF38s2 Lechevalieria aerocolonigenes

1 MVVDHRSAEFHDFFERHHAELARFAWLLTGEAGAADDLAADALVALWQRW
51 DRLRAAENPLAYARGVVANLARERIRSATRERRRIALFFSRGPQQTHGPD
101 LAAVVDVRAALDRLPFRKRACVILRHAFDLSEKDTALALGISVGAVKSQT
151 SKGMAELERILGPHAAGDVMTGRGTR

Name Aliases LCA Taxa Group Subgroup
ECFp26338
  • RNA polymerase sigma factor
  • SSPG_05672
  • ... more
Streptomyces ECF38 ECF38s2

>ECFp26338 ECF38 ECF38s2 Streptomyces

1 MGTVVDDAAAGEFRAFFERHYAELARLAHLLTGEPDAADDLAADALLALW
51 HRWDRVRAADHPVAYARGVVANLARTRVRAAVRERRRVALFWSQREERTE
101 NPDVAGVVDVREALRRLPFRKRACVVLRHSFDLSEKDTALALGISVGTVK
151 SQTSKGVAELQRLLGTRTAPRAPGQVRAAIAHSGETAGGAR

Name Aliases LCA Taxa Group Subgroup
ECFp26325
Frankia sp. R43 ECF38 ECF38s2

>ECFp26325 ECF38 ECF38s2 Frankia sp. R43

1 MSVDSVAELGAHSPRLRTDHRPRWDPTLLDPTLLEAVPLEAAPPDWGAEL
51 LATSSDVVTQWGGDTEEPEPLPEHPADGSGHLAGQPNARHEFQIFFENHH
101 RELSRFAYLLTGDRDVADDLTADALTAAWSRWDRVSAADSPIAYVRRILA
151 NLATSRLRRMIRERRGLAVLGMMGDHAGQAREHADLPAAVDLRAALMALP
201 ARKRACVVLRYAFDLSEAETARILGVSVGTVKSQTSKAVTELERLLGARP
251 DLSPPHEAGRSVPQQEPPTTRSAAARRGGAPRSRRRVGGAVDPAAAARSA
301 LNRLREGEAHGRLRGSES

Name Aliases LCA Taxa Group Subgroup
ECFp26334
Frankia sp. QA3 ECF38 ECF38s2

>ECFp26334 ECF38 ECF38s2 Frankia sp. QA3

1 MEAVAADDEHEHPHRQAEFHAFFESHHRALSRFAYLLTGDHDAADDITAE
51 ALTAAWSSWDRVRSAELPLAYVRRIVANLAADRVRKVVRERRGLLVLGQR
101 AERSAPVPDVPAVVDLRTALMSLPPGKRACVVLRYAFDLSEVETARTLGI
151 SVGTVKSQTAKGVAELERILKRTELPPAETTQEEVTSRMTPEHPDMPQGG
201 TSRPGTSRISGVRPGSGRPGGGPGTGQSDEPAGPDRSAFARTDEAEPAPG
251 AGRHPGGEPFPGPGRLSRPVPLPRREPPRRRPLPWHEPVAWREPVAWREP
301 LPWPEPAPRLERPGWPGRPSLAGSPTWPESLPWPRLAWPVWRVGEA

>ECFp26343 ECF38 ECF38s2 Streptomyces sp. NRRL F-5135

1 MSTVLDDTAAAEFHAFFERHYAELSTLAYLLTGEADTADDLASDALLAMW
51 RHWDRVRAADHPVAYARGVVANLVRSRIRSAVRERRRISLFWSQRPEGFD
101 GPDVPVVLDVRAALGRLPFRRRACVVLRYAMDLSERDTALALGISVGTVK
151 SQSSRGMAELQRLLGTGAAEAGIHAKVAVGRMEKRC

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more