ECF proteins of ECF subgroup ECF38s2

Displaying ECF 41 - 60 of 393 in total
Name Aliases LCA Taxa Group Subgroup
ECFp112466
  • RNA polymerase sigma factor
  • A3CQ_RS0116215
Actinoplanes globisporus DSM 43857 ECF38 ECF38s2

>ECFp112466 ECF38 ECF38s2 Actinoplanes globisporus DSM 43857

1 MRDQAFHAFFERHHAALSGLAFLLTADKTAADDLAADALTEVWKHWDRVS
51 AAGDPAAYAKGIVANLARNWLRRQGRARRGLALLGLGGDRAPGPDVPAVL
101 DVRTALKRLPYRRRACVVLRYAFDLPEREVADILGISVGAVKSQTSRGAK
151 QLADLLRDLKFDPEVAR

Name Aliases LCA Taxa Group Subgroup
ECFp114303
  • RNA polymerase sigma factor
  • putative RNA polymerase ECF-subfamily sigma factor
  • ... more
Streptomyces himastatinicus ATCC 53653 ECF38 ECF38s2

>ECFp114303 ECF38 ECF38s2 Streptomyces himastatinicus ATCC 53653

1 MARLAHLLLGSSDGADDLAADALVAVWHRWDRVRVAEHPAAYARGVVANL
51 ARSRIRSLVRERRRVALFSSERLDRVDDPDVSAMVDVQAALVRLPFRKRA
101 CVVLRHAFDLSERDTARTLGISVGTVKSQTSRGIAELERLLGPPDDDTER
151 PAAGTQAQAPPPAPSAQETVRGLRPGRVGHAGHPGGNG

Name Aliases LCA Taxa Group Subgroup
ECFp116364
  • RNA polymerase subunit sigma
  • CRYAR_RS39835
Cryptosporangium arvum DSM 44712 ECF38 ECF38s2

>ECFp116364 ECF38 ECF38s2 Cryptosporangium arvum DSM 44712

1 MASLITGDSSVADDLAADALAEIWRYWDRVRAADDPLAYARGVLVNVARS
51 WNRRNGLEEHSARLLGLFRRDERTAEADVPAALDVRAALARLPYRRRACV
101 VLRYAFDVSEREVADILGISVGTVKSQTSRGAAQLAALIAATDGSVDPRA
151 ALVRSVAGGRRGATGGAR

>ECFp116465 ECF38 ECF38s2 Streptomyces sparsogenes

1 MARLAHLLLGSSDGADDLAADALVAVWHQWDRVRAAEHPAAYARGVVANL
51 ARSRIRSLVRERRRVALFSSQRADHVDDPDVSAVVDVQAALVRLPFRKRA
101 CVVLRHAFDLSERETARTLGISVGTVKSQTSRGIAELERLLGSAHGGERP
151 PVPGPQETVRKLHPGHAGGNGR

Name Aliases LCA Taxa Group Subgroup
ECFp26375
  • hypothetical protein
  • B207_RS0109075
Frankia elaeagni ECF38 ECF38s2

>ECFp26375 ECF38 ECF38s2 Frankia elaeagni

1 MAEDRGAAEFQDFFASHHRELARFAYLLTGDHDVADDLTADALTAAWSRW
51 DRVSAADSPIAYVRRIVANLATSRLRRVIRERRGMTMLGMLADSSGHATD
101 GGDLTAAVDLRAALMALPVRKRACVVLRYAFDLSEAETARVLGISTGTVK
151 SQTSKAVVELERLLGTCPDLLPPDLPAGPARRREQAAPPAHKPGARRAVA
201 PRSRRRPAGAGDPAAATRSALHRLRDGEAHGRLRGSES

>ECFp26615 ECF38 ECF38s2 Kibdelosporangium aridum subsp. largum

1 MLLNDASAEFHDFFEQHYAELARLAYLLTGETDAADDVAADALIALWQRW
51 DRLRQAQHPLAYARGVVANLARERIRSATRERRRIALFWSRGPQQVHGPD
101 VATVVDVRAALGQLPFRKRACVVLRHAFDLSEKDTALALGISVGAVKSQT
151 SKGLAELERILVVRASGDMVAGRRSR

>ECFp139772 ECF38 ECF38s2 Streptomyces sp. ScaeMP-e83

1 MADDASAEFHDFFDRHHAELARLAHLLTGGAADADDLAADALVALWDRWD
51 RVRAAEHPVAYARGVVANMARSRIRAAVRERHRVALFWSRRGDPAEGPDV
101 AAVLDVRQALGRLPFRKRACVVLRHAFDLSEKDTALALGISVGTVKSQTS
151 KGMAELERLLDGRTSLELAGRGER

>ECFp139769 ECF38 ECF38s2 Streptomyces sp. MUSC 1

1 MVLDDASAEFHEFFERHYAELARLAYLLTGETDAADDLAADALVALWQRW
51 DRLRQADHPLAYARGVVANLARGRIRSAVRERRRITLFWSRSPQKVEGPD
101 MAAVLDVRAALARLPFRKRACVVLRHAFDLSEKDTAVALGISVGTVKSQT
151 SKAMAELERILGARAVGDLVAGRRNR

>ECFp139774 ECF38 ECF38s2 Streptomyces radiopugnans

1 MVLDDASAEFHDFFEHHHAELARLAYMLTGEPDTAEDLVADALVELWHRW
51 DRVRRADHPVAYARGVVANKARSRIRSAVRERRRIALFRLHRSERVDDPD
101 VAAAVDVRTALARLSFGKRACVVLRHALDLSEKETALALGVSVGTVKSQT
151 SKGMAELRRLLGTRAAGELVGREH

>ECFp139773 ECF38 ECF38s2 Streptomyces

1 MGTAVDDAAAAEFHEFFEAHYAELARLALLLTGEADAADDVAADALLALW
51 HRWDRVRNADHPVAYARGVVANLARTRIRSAVRERRRIALFWAPRGGGDG
101 YAFDDPDVSTVVDVQGALRRLPFRKRACVVLRHAFDLSERDTALVLGISV
151 GTVKSQTSRAVAELQRLLGPDTPAARVQVAVAAQRGGGRH

>ECFp139779 ECF38 ECF38s2 Streptomyces sp. DI166

1 MGTVVDDAASAEFHAFFERHFAELSRLAHLLTGEADAADDLAADALLALW
51 HRWDRVRAADHPVAYARGVVANLARTRIRSAVRERRRIALFWSHREERTE
101 NPDVAGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGPQAAPLRMQAAMARSGDTAGRDR

>ECFp139784 ECF38 ECF38s2 Streptomyces sp. MUSC 1

1 MGTVVDDAASVEFHAFFERHHAELSRLAHLLTGESDAADDLAADALLALW
51 HRWDRVRAADHPVAYARGVVANLARTRIRSAVRERRRIALFWSHREERTE
101 NPDVAGVVDVREALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGLAELHRLLGPQGDPRRMHAAMTARAGESGGRNR

>ECFp139793 ECF38 ECF38s2 Streptomyces sp. SolWspMP-5a-2

1 MGTVVDDAASAEFHAFFERHYAELARLAHLLTGEADAADDLAADALLALW
51 HRWDRVRAADHPVAYARGVVANLARTRIRSAVRERRRISLFWSQREERTE
101 NPDVAGVVDVQEALRVLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKAMAELQRLLGPGAVPQRVHAAMARGGETGGADR

>ECFp139789 ECF38 ECF38s2 Mycobacterium tuberculosis

1 MAVVREQVWERSHAREFQGFFRRHHRELARLAFVLLGDPDGADDVAADAL
51 AAAWRRWDRVRAADQPLAYVRRMVVNMSRSRIRVLVRERDRAGRLGAGLD
101 ERVHGPDVPAIVDVRAALLRLPQRKRACVVLRLAFDLSEKETAQLLGIAV
151 GTVKSQTAKGVAELARLLADGHGRAATFRAPPGD

Name Aliases LCA Taxa Group Subgroup
ECFp139804
Streptomyces pini ECF38 ECF38s2

>ECFp139804 ECF38 ECF38s2 Streptomyces pini

1 MDAPAEEFHAFFDRHYADLSRFAHLLLGDSEGADDLAADALVAVWRRWDS
51 VRVGGHPLAYARSVVAGMARTRLRSLLREHRRVALFWSHRPDRIDDPDVP
101 AVLDVRDALARLPLRKRTCVVLRHAFDLSEKETARTLGVSVGTVKSQTSR
151 GIAELERMLAPARTGSGRAHGTAGALRAGSAGRSGW

Name Aliases LCA Taxa Group Subgroup
ECFp139783
Streptomyces sp. PRh5 ECF38 ECF38s2

>ECFp139783 ECF38 ECF38s2 Streptomyces sp. PRh5

1 MSAPADDAAASGTARAVRMDAARMTDPPRDPGAPGHVSPQAPDAPEDPDG
51 LPAEALPPDALPADPQAEFRDFFERHHAELARLAHLLLGSSDGADDLAAD
101 ALVAVWHQWDRVRAADHPAAYARGVVANLARSRIRSMMRERRRVALFSSQ
151 RPDRVDDPDVSAVVDVQAALVRLPFRKRACVVLRHAFDLSERETARTLGI
201 SVGTVKSQTSRGIAELERLLGPPDGEDGEDGKELSAATEAERTGRTVRTL
251 RAGNTGHTSHTGPTRHSGHMGHAGHAGGGS

>ECFp139799 ECF38 ECF38s2 Actinoplanes philippinensis

1 MSEIGTEYAFRRFFDDHHIDLSRLAYLVTGDSQAADDLAADAFVEVWRHW
51 ERVQAADSPIAYARGIVTNLARQWIRKQTRERSGLLRLGLLRRERGESDT
101 PAVLDVRAALQRLPQRRRECVVLRYAFDVPEREVATILGISVGAVKSHTS
151 RGAAQLSEFLRGMPLMMGGHHG

Name Aliases LCA Taxa Group Subgroup
ECFp139805
Frankia irregularis ECF38 ECF38s2

>ECFp139805 ECF38 ECF38s2 Frankia irregularis

1 MSVDSVAELGAHSPRLRTDRRPRWDPTLLDPALLEAVPLEAAPPDWEAEL
51 LATSSDVVTRWGGDTEEPEPLPEHPADGSDHLAGQPNARHEFQIFFENHH
101 RELSRFAYLLTGDRDVADDLTADALTAAWSRWDRVSAADSPIAYVRRILA
151 NLATSRLRRMIRERRGLAVLGMMGDHAGQAREHADLPAAVDLRAALMALP
201 ARKRACVVLRYAFDLSEAETARILGVSVGTVKSQTSKAVTELERLLGARP
251 DLSPPHEAGRSVPQQEPPTTRSAAARRGGAPRSRRRVGGAVDPAAAARSA
301 LNRLREGEAHGRLRGSES

>ECFp139801 ECF38 ECF38s2 Streptomyces sp. PpalLS-921

1 MGTVVDDAAAAEFHAFFEAHYAELARLARLLTGEADAADDLAADALTALW
51 HRWDRVRGADHPVAYARGVVANLARTRIRSAVRERRRVALFWAPRGGGDG
101 YAVEDPDVSAVVDVQEALRRLPFRKRACVVLRHAFDLSERDTSLVLGISV
151 GTVKSQTSRAMAELHRLLGPEGPAVRVQVAAAAQRTGGRR

>ECFp139812 ECF38 ECF38s2 Streptomyces sp. yr375

1 MGTVVDDAASVEFHAFFDRHYAELSRLAHLLTGEADAADDLAADALLALW
51 HRWDRVRAADHPVAYARGVVANLARTRIRSAVRERRRIALFWSQREEKTE
101 NPDIAGTVDVQSALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGAKGAALTMPAMVRTGEASGRDR

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more