ECF proteins of ECF subgroup ECF38s2

Displaying ECF 21 - 40 of 393 in total

>ECFp26799 ECF38 ECF38s2 Streptomyces violaceoruber

1 MGTAVDDAASVEFHAFFERHYAELSRLAHLLTGEADAADDLAADALLALW
51 NRWDRVRAADHPAAYARGVVANLARTRIRSAVRERRRVALFWSQREEKTE
101 NPDVAGVVDVQDALRRLPFRKRACVVLRHAFDLSEKDTALTLGVSVGTVK
151 SQTSKGMAELQRLLGTQAAPQKVHAAMARTGEAGGGDR

>ECFp26794 ECF38 ECF38s2 Streptomyces ossamyceticus

1 MGTVVDDAASVEFHDFFERHYAELSRLAHLLTGEADAADDLAADALLAMW
51 HRWDRVRAAEHPVAYARGVVANLARTRIRSAVRERRRITLFWSQREEKAE
101 NPDVAGAVDVQSALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQKLLGTGDAPKRMPAGITGTGVAGARVTGAGAPGSGGRDR

>ECFp26786 ECF38 ECF38s2 Streptomyces sp. NRRL WC-3618

1 MGKLRDFKGDRSPVGTVVDDAASVEFHAFFERHYAELARLAHLLTGEADA
51 ADDLAADALLALWNRWDRVRAADHPVAYARGVVANLAKTRIRSAVRERRR
101 ISLFWSQREEKTENPDIPGVVDVQTALRKLPFRKRACVVLRHAFDLSEKD
151 TALALGVTVGTVKSQTSKGMAELQRLLGADKNPLRMRTPVRTTGGTGGTN
201 R

>ECFp26708 ECF38 ECF38s2 Streptomyces xylophagus

1 MGTVVDDAASVEFHAFFERHYAELSRLAHLLTGEADAADDLAADALLALW
51 HRWDRVRAADHPAAYARGVVANLARTRIRSAVRERRRVALFWSQREEKTE
101 NPDVAGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGPQSPPLRMHATMARGGETGGRNR

>ECFp26686 ECF38 ECF38s2 Streptomyces puniciscabiei

1 MGTVVDDAASVEFHAFFERHYAELSRLAALLTGEADAADDLAADALLALW
51 HRWDRVRAADHPVAYARGVVANLARTRIRSAVRERRRIALFRSHREERTE
101 NPDVPGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELARLLGPQGDPRRVHAAMAARGGGSGGRNR

>ECFp26662 ECF38 ECF38s2 Streptomyces sp. CNT371

1 MGIPSAGRDAAATAEFREFFEHHYAELARLANSLSGEADGADDVAADALV
51 ALWHRWDRVRAADHPAAYARGVVANLVRSRIRSAVRERRRIALYWTDSHE
101 RVEGPDVPAVVDVREALRGLTFRKRACVVLRHAFDLSERETAHTLGISVG
151 TVKSQTAKGVAQLEQALGSDAQPALGRVRRA

>ECFp26606 ECF38 ECF38s2 Streptomyces peruviensis

1 MGTVVDDAASVEFHAFFERHYAELSRLAHLLTGEADAADDLAADALLALW
51 HRWDRVRAADHPVAYARGVVANLARTRIRSAVRERRRIALFWSQREEKTE
101 NPDVAGAVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGARGAPLKVHAAPMARTGNAGGRNR

>ECFp26592 ECF38 ECF38s2 Streptomyces ochraceiscleroticus

1 MQPTVAGRADAAAEFHAFFERHHAELARLARLLTGEAEGADDLAADALVA
51 LWRRWDRVRAADHPAAYARGVVANLARSHIRSAIRERRRITLFWAQCSDH
101 AEAPDVPAVVDVQQALRTLPFRKRACVVLRHAFDLSERETALALGISVGT
151 VKSQTSKGMAQLERLLGPRTTTELIGGRT

Name Aliases LCA Taxa Group Subgroup
ECFp26480
  • RNA polymerase sigma factor
  • IG99_RS00530
Streptomyces griseus subsp. griseus ECF38 ECF38s2

>ECFp26480 ECF38 ECF38s2 Streptomyces griseus subsp. griseus

1 MGTVVDDAASVEFHAFFERHYAELSRLAHLLTGESDAADDLAADALLALW
51 NRWDRVRAADHPVAYARGVVANLARTRIRSAVRERRRIALFWSQREEKTE
101 NPDIAGVVDVQSALRRLPFRKRACVVLRHAFDLSEKDTALALGISVGTVK
151 SQTSKGMAELQKLLGTQRAPQRVRVVMARTGEAGGRDR

>ECFp26475 ECF38 ECF38s2 Streptomyces longwoodensis

1 MGTVVDDAASVEFHAFFEAHYAELSRLARLLTGEPDAADDLAADALLALW
51 HRWDRVRAADHPVAYARGVVANLARTRVRSAVRERRRISLFWSQREERTE
101 NPDVAGVVDVQSALRRLPFRKRACVVLRHAFDLSEKDTALALGISVGTVK
151 SQTSKGVAELQKLLGAQGAPHRVHAVMARTSEAGGRDR

Name Aliases LCA Taxa Group Subgroup
ECFp26457
Streptomyces sp. RV15 ECF38 ECF38s2

>ECFp26457 ECF38 ECF38s2 Streptomyces sp. RV15

1 MGTVVDDAASVEFHAFFERHYAELSRLAHLLTGEADSADDLAADALLALW
51 HRWDRVRAADRPAAYARGVVANLARTKIRSAVRERRRVALFWSQREERTE
101 NPDVAGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGTQGAAPLQVHAAMARTGDAGGRDR

>ECFp26455 ECF38 ECF38s2 Streptomyces

1 MGTVVDDAAAAEFHAFFEAHYAELARLARLLTGEADAADDLAADALTALW
51 HRWDRVRGADHPVAYARGVVANLARTRIRSAVRERRRVALFWAPRGGGDG
101 YAVEDPDVSTVVDVQGALRRLPFRKRACVVLRHAFDLSERDTSLVLGISV
151 GTVKSQTSRAMAELHRLLGPEGPAVRVQVAAAAQRTGGRR

Name Aliases LCA Taxa Group Subgroup
ECFp26384
  • RNA polymerase subunit sigma
  • AOK17_RS34170
Streptomyces phaeochromogenes ECF38 ECF38s2

>ECFp26384 ECF38 ECF38s2 Streptomyces phaeochromogenes

1 MGTVVDDAASVEFHDFFERHYAELARLAHLLTGESDAADDLAADALLALW
51 HRWDRVRAADHPVAYARGVVANLARSRIRSAVRERRRITLFWSQREDKTE
101 NPDIPGMVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGISVGTVK
151 SQTSKGMAELQRLLGSQEAPRRMHAAVLRATGAEGRER

>ECFp26373 ECF38 ECF38s2 Streptomyces sclerotialus

1 MGTVVDDAASVEFHAFFERHYAELARLAHLLTGEADAADDLAADALLAMW
51 HRWDRVRAADHPVAYARGVVANLARTRIRSAVRERRRITLFWSQREEKTE
101 NPDVPGMVDVQGALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGAQEAPRQMHRAAVSGATGGRDR

>ECFp176762 ECF38 ECF38s2 Streptomyces sp. CB02414

1 MGTFVDDAASAEFHAFFERHYAELARLAHLLTGEPDAADDLAADALLALW
51 HRWDRVRAADRPAAYARGVVANLARTRVRTAVRERRRVALFWSQREERTE
101 NPDVAGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGTRAAVGQVHAAIARSGGAAGRNR

>ECFp176741 ECF38 ECF38s2 Streptomyces sp. 2114.2

1 MGTVVDDAAAGEFRAFFERHYAELARLAHLLTGEPDAADDLAADALLALW
51 HRWDRVRAADHPVAYARGVVANLARTRVRAAVRERRRVALFWSQREERTE
101 NPDVAGVVDVGEALRRLPFRKRACVVLRHSFDLSEKDTALALGISVGTVK
151 SQTSKGVAELQRLLGTRTAPRAPGQVRAAIAHSGETAGGAR

>ECFp176736 ECF38 ECF38s2 Streptomyces sp. MP131-18

1 MSGPSDEFHAFFEQHHAELSRLARLLLGGTEGADGADDLAADALVAIWHR
51 WDRVRAADHPLAYARGVVANLARSRIRSRVRERRRIALFWSRGVEPAEGP
101 DVPAVLDVRAALGRLPYRKRACVVLRHAFDLSEQETARALGISVGTVKSQ
151 TSRGMAELQRLLVEAAAPEGEGGTGEFLRALRTGPVQRRSW

>ECFp176731 ECF38 ECF38s2 Streptomyces sp. CB02460

1 MGTSVDDAAAAEFHAFFEAHYAELARLAHLLTGEADAADDLAADALLALW
51 HRWDRVREAGNPVAYARGVVANLARTRIRSAVRERRRIALFWAPRGGGDD
101 GAAEGPDVPAVVDVREALRRLPFRKRACVVLRHAFDLSERDTSLVLGISV
151 GTVKSQTSRAVAELQRLLGPETPAARVRLAVAAQRGGGER

>ECFp176698 ECF38 ECF38s2 Streptomyces sp. AmelKG-A3

1 MGTVVDDAAAAEFHAFFEAHYAELARPARLLTGEADAADDLAADALTALW
51 HRWDRVRGADHPVAYARGVVANLARTRIRSVVRERRRIALFWAPRGGGDG
101 YAVEDPDVSAVVDVQGALRRLPFRKRACVVLRHAFDLSERDTSLVLGISV
151 GTVKSQTSRAMAESHRLLGPGGPAVRVQVAVAAQRTGGRR

>ECFp176696 ECF38 ECF38s2 Streptomyces sp. TSRI0107

1 MGTVVDDAASVEFHAFFERHYAELSRLAHLLTGESDAADDLAADALLALW
51 HRWDRVRAADHPAAYARGVVANLARTRIRTAVRERRRISLFWSQREEKTE
101 NPDVAGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGTQQAPQRVRAAMARTGQAAGRDR

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more