ECF proteins of ECF subgroup ECF38s2

Displaying ECF 341 - 360 of 393 in total
Name Aliases LCA Taxa Group Subgroup
ECFp91438
  • RNA polymerase sigma factor
  • WH85_RS16835
Actinoplanes rectilineatus ECF38 ECF38s2

>ECFp91438 ECF38 ECF38s2 Actinoplanes rectilineatus

1 MRDDAFHAYFERHHASLSRLAYLMTGESDVADDLAADALTEIWRHWDRVT
51 AAADPAAYGHGVVMNLARNWVRRRSRERLLTLEAFRRGRDTDVPAVLDVR
101 GALRRLPERRRACVVLRYAFDMPEREVAGILGISVGAVKSATSRGAKQLA
151 DILGDSARFDGWEAAR

Name Aliases LCA Taxa Group Subgroup
ECFp95291
  • RNA polymerase sigma factor
  • RNA polymerase sigma factor sigZ
  • ... more
Actinoplanes sp. SE50/110 ECF38 ECF38s2

>ECFp95291 ECF38 ECF38s2 Actinoplanes sp. SE50/110

1 MPETDDEGAFRRFFDEHHADLSRLAYLVTGETQVADDLASDAFVEVWRHW
51 ARVCAADSPIAYARGIVTNLARQWIRKQTRDRAGLLRLGLLRRDRGETDT
101 PAILDVRAALRRLPLRRRECVILRYAFDVPEKEVAAILGISLGAVKSHTS
151 RGAAQLSEFLREMPLTTGGHHG

>ECFp95928 ECF38 ECF38s2 Streptomyces sp. RTd22

1 MARLAHLLLGSSDGADDLAADALVAVWHRWDRVRVAEHPAAYARGVVANL
51 ARSRIRSLVRERRRVALFSSERSDRVDDPDVSAMVDVQAALVRLPFRKRA
101 CVVLRHAFDLSERDTARTLGISVGTVKSQTSRGIAELERLLGPPDDDPER
151 PAAGTQAQAPPPAPSAQETVRGLRPGRVGHAGHPGGNG

Name Aliases LCA Taxa Group Subgroup
ECFp176684
  • RNA polymerase subunit sigma-24
  • CC117_07725
Frankia sp. Cc1.17 ECF38 ECF38s2

>ECFp176684 ECF38 ECF38s2 Frankia sp. Cc1.17

1 MAEDRGAAEFQDFFASHHRELARFAYLLTGDHDVADDLTADALTAAWSRW
51 DRVSAADSPIAYVRRIVANLATSRLRRVIRERRGMTMLGMLADSSGHATD
101 GGDLTAAVDLRAALMALPVRKRACVVLRYAFDLSEAETARVLGISTGTVK
151 SQTSKAVVELERLLGTCPDLVPPDIPAGATRRREQAAPPAHKPGTRRAVA
201 SRSRRRPAGAGDPAAATRSALHRLRDGEAHGRLRGSES

>ECFp176675 ECF38 ECF38s2 Streptomyces sp. 3213.3

1 MVLDDTSAEFHEFFERHYAELARLAHLLTGETDAADDLAADALVALWQRW
51 DRLRQADHPLAYARGVVANLARARIRSTVRERRRITLFWARSPEKVEGPD
101 MAAVLDVRAALDRLPFRKRACVVLRHALDLSEKDTAAALGISVGTVKSQT
151 SKAMAELEKLLGAHAAGDLVEGRRNR

>ECFp26412 ECF38 ECF38s2 Streptomyces sp. NRRL S-495

1 MLLDDASAEFHDFFERHYAELARLAHLLTGEPDAADDLAADALIALWRRW
51 DRLRAAEHPLAYARGVVANMARARIRSTVRERRRVLMFWSRAPERTDGPD
101 VAAVLDIRTALDRLPFRKRACVVLRHAFDLSEKDTAAALGISVGTVKSQT
151 SKGMAELQRALGARAVGELATGRRNR

>ECFp26882 ECF38 ECF38s2 Streptomyces durhamensis

1 MLLDDASAEFHEFFERHYAELARLAHLLTGETDAADDLAADALVALWQRW
51 DRLRQADHPLAYARGVVANLARGRIRSAVRERLRITLFWSRSPEKVEGPD
101 MAAVLDVRAALARLPFRKRACVVLRHAFDLSEKDTAAALGISVGTVKSQT
151 SKGMAELERILGARAVGDLVAGRRNR

>ECFp27102 ECF38 ECF38s2 Streptomyces sp. NRRL S-646

1 MVLEDASAEFHEFFERHYAELARLAHLLTGEADAADDLAADALVALWQRW
51 DRLRQADHPLAYARGVVANLARGRIRSAVRERLRITLFWSRSPEKVEGPD
101 MAAVLDVRAALARLPFRKRACVVLRHAFDLSEKDTAVALGISVGTVKSQT
151 SKGMAELERILGAGTVGDLVAGRRNR

>ECFp139794 ECF38 ECF38s2 Streptomyces sp. OspMP-M45

1 MGTVVNDAAAAEFHAFFEAHYAELARLARLLTGEADAADDLAADALTALW
51 HRWDRVRGADHPVAYARGVVANLARTRIRSAVRERRRVALFWAPRGGGDG
101 YAVEDPDVSAVVDVQEALRRLPFRKRACVVLRHAFDLSERDTSLVLGISV
151 GTVKSQTSRAMAELHRLLGPEGPAVRVQVAAAAQRTGGRR

>ECFp139797 ECF38 ECF38s2 Streptomyces sp. DvalAA-14

1 MGTAIGDDAAAFHAFFERHYAELARLAALLTGEADAADDLAADALVVLWR
51 HWDRVRAARHPAAYARGVVTNLARSRIRSAVRERRRVALFWSQRGERVEE
101 PDVPAVLDLRDALQRLPFRKRACVVLRHAFDLSEKDTAEALGVSVGTVKS
151 QTSRGVAELERLLAPLPAGPDTVPAVGRAAAAGPDAARILGAPAPPRRAR
201 TRTGRGV

>ECFp139834 ECF38 ECF38s2 Streptomyces

1 MGTPAEDAAAEFHEFFERHYAELARLAHLLTGEADAADDLAADALLAMWH
51 RWDRVRTARHPAAYARGVVAHMARSRIRSAVRERRRIALFWDRRPEHTDD
101 PDVPAVIDVQGALRRLPFRKRACVVLRHAFDLSERETARALGISVGTVKS
151 QTSKGMAQLEQLLGGRSAASQLVGGRK

>ECFp139840 ECF38 ECF38s2 Streptomyces sp. MUSC 14

1 MGTVVDDAASVEFHAFFERHYAELSRLACLLTGESDAADDLAADALLALW
51 HRWDRVRAADHPVAYARGVVANLARTRIRSAVRERRRIALFWSHREERTE
101 NPDVAGVVDVRGALRGLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGPQGDPRRVHEAMAARAGENGGRNR

Name Aliases LCA Taxa Group Subgroup
ECFp176663
Streptomyces alfalfae ECF38 ECF38s2

>ECFp176663 ECF38 ECF38s2 Streptomyces alfalfae

1 MPSAADDAAAEFHAFFERHYAELARLAHLLTGEADGADDLAADALLALWH
51 RWDRVRAADHPAAYARGVVANMARSRIRSAVRERRRVTLFWSGRGEDVAD
101 PDIPAVVDVRDALRALPFRKRACVVLRHAFDLSEKDTAQALGISVGTVKS
151 QTSKGMAELQRRLGPQAAWERVRAVTADTGGST

Name Aliases LCA Taxa Group Subgroup
ECFp176664
Streptomyces indicus ECF38 ECF38s2

>ECFp176664 ECF38 ECF38s2 Streptomyces indicus

1 MDEPTDAAAEFHAFFEAHYAELSRLARLLTGDADGADDLAADALLALWHR
51 WDRVRAADHPAAYARGVVANMARARIRSAVRERRRMTLFWSGQSERSEDP
101 DIPAVVDVQEALRLLPFRKRACVVLRHGFDLSEKDVAKALGISVGTVKSQ
151 TSKGMAELQRALGREQVLHRIRMTVADAGGQH

>ECFp176672 ECF38 ECF38s2 Streptomyces sp. CB02058

1 MGTVVDDAAAAEFHAFFEAHYAELARLAHLLTGEADAADDLAADALMALW
51 HRWDRVRGADHPAAYARGVVANLARTRIRSAVRERRRIALFWAPRGAGDG
101 YAADGPDVSAVVDVQGALRRLPFRKRACVVLRHAFDLSERDTALVLGISV
151 GTVKSQTSRGVAELQRLLGSETPAAQVQVAVAGQRTGGRH

Name Aliases LCA Taxa Group Subgroup
ECFp176695
  • RNA polymerase sigma-70 factor, sigma-E family
  • SAMN05216499_10682
Streptomyces paucisporeus ECF38 ECF38s2

>ECFp176695 ECF38 ECF38s2 Streptomyces paucisporeus

1 MGTAVDDDAAAFHAFFERHYAELARLAHLLTGEADAADDLAADALVALWR
51 RWDRVRTADHPVAYARGVVANLARSRIRSAMRERRRVALFWSQRPERTDG
101 PDLPAVLDLREALQRLPFRKRACVVLRHAFDLSERDTAAALGISVGTVKS
151 QTSRGIAELERLLEPWTAEAGTVQEAGSAAVRSPAGPERLPRAARPAGAA
201 GAANGAAGEIGPGAQRLLGAAGPATRARTRTGRGM

>ECFp176696 ECF38 ECF38s2 Streptomyces sp. TSRI0107

1 MGTVVDDAASVEFHAFFERHYAELSRLAHLLTGESDAADDLAADALLALW
51 HRWDRVRAADHPAAYARGVVANLARTRIRTAVRERRRISLFWSQREEKTE
101 NPDVAGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGTQQAPQRVRAAMARTGQAAGRDR

>ECFp176698 ECF38 ECF38s2 Streptomyces sp. AmelKG-A3

1 MGTVVDDAAAAEFHAFFEAHYAELARPARLLTGEADAADDLAADALTALW
51 HRWDRVRGADHPVAYARGVVANLARTRIRSVVRERRRIALFWAPRGGGDG
101 YAVEDPDVSAVVDVQGALRRLPFRKRACVVLRHAFDLSERDTSLVLGISV
151 GTVKSQTSRAMAESHRLLGPGGPAVRVQVAVAAQRTGGRR

>ECFp176731 ECF38 ECF38s2 Streptomyces sp. CB02460

1 MGTSVDDAAAAEFHAFFEAHYAELARLAHLLTGEADAADDLAADALLALW
51 HRWDRVREAGNPVAYARGVVANLARTRIRSAVRERRRIALFWAPRGGGDD
101 GAAEGPDVPAVVDVREALRRLPFRKRACVVLRHAFDLSERDTSLVLGISV
151 GTVKSQTSRAVAELQRLLGPETPAARVRLAVAAQRGGGER

>ECFp176736 ECF38 ECF38s2 Streptomyces sp. MP131-18

1 MSGPSDEFHAFFEQHHAELSRLARLLLGGTEGADGADDLAADALVAIWHR
51 WDRVRAADHPLAYARGVVANLARSRIRSRVRERRRIALFWSRGVEPAEGP
101 DVPAVLDVRAALGRLPYRKRACVVLRHAFDLSEQETARALGISVGTVKSQ
151 TSRGMAELQRLLVEAAAPEGEGGTGEFLRALRTGPVQRRSW

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more