ECF proteins of ECF subgroup ECF38s2

Displaying ECF 321 - 340 of 393 in total
Name Aliases LCA Taxa Group Subgroup
ECFp27086
  • RNA polymerase sigma factor
  • IG86_RS0132505
Streptomyces ECF38 ECF38s2

>ECFp27086 ECF38 ECF38s2 Streptomyces

1 MTEDEAAADFRAFFERHHAELSRLAYLLTGEADAADDLAADAMVALWHHW
51 DRARRADSPAAYARGIVANLARSRIRSTVRERRRVLLFWSHRPERTDGPD
101 MAAVMDVRAALDTLPFRKRACVVLRHAFDLSEKDTAAALGISVGTVKSQT
151 SKGTAELQRLLGARAADELVGRGTR

>ECFp27087 ECF38 ECF38s2 Streptomyces

1 MTEDERAADFHAFFERHHAELSRLAYLLTGEADAADDLAADAMVALWHRW
51 DRARRADSAAAYARGIVANLARSRIRSTVRERRRVLLFWSHRPERTDGPD
101 IAAVMDVRAALDTLPFRKRACVVLRHAFDLSEKDTAAALGISVGTVKSQT
151 SKGTAELQRLLGARAADELVGRGSR

Name Aliases LCA Taxa Group Subgroup
ECFp27101
  • RNA polymerase sigma factor
  • SSP08S_RS25485
Streptomyces hokutonensis ECF38 ECF38s2

>ECFp27101 ECF38 ECF38s2 Streptomyces hokutonensis

1 MVLDDASAEFHEFFERHYAELARLAYLLTGETDAADDLAADALVALWQRW
51 DRLRQADHPLAYARGVVANLARGRIRSAVRERRRLALFWSRSPEKADGPD
101 MAAVLDVRAALARLPFRKRTCVVLRHAFDLSEKDTAEALGISVGTVKSQT
151 SKGMAELERILGARAAGDLVAGRRNR

>ECFp27088 ECF38 ECF38s2 Streptomyces acidiscabies

1 MGTVVDDAASVEFHAFFDRHYAELSRLAYLLTGESDTADDLAADALLALW
51 HRWDRVRAADHPVAYARGVVANLARTKIRSAVRERRRIALFWSQREEKTE
101 NPDVAGVVDVQSALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQKLLGAEKAPKRVHAVMARTSDSAGRDR

>ECFp27091 ECF38 ECF38s2 Streptomyces

1 MRTVGDDAASAEFHAFFERHYAELARLAHLLTGEPDAADDLAADALLALW
51 HRWDRVRAADHPVAYARGVVANLARTRVRSAVRERRRVALFWSPREERTE
101 DPDVAGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGVAELQRLLGTPAAPRAPRQVHAAIARSGGAAGGAR

>ECFp27092 ECF38 ECF38s2 Streptomyces sp. CdTB01

1 MGTVVDDAASMEFHAFFERHYAELSRLAHLLTGEADAADDLAADALLALW
51 HRWDRVRAAEQPVAYARGVVANLARTRIRSAVRERRRVSLFWSQREERTE
101 NPDIAGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQKVLGSRGGPQKVQAAMARGGETGGTAR

Name Aliases LCA Taxa Group Subgroup
ECFp27083
  • RNA polymerase sigma factor
  • RNA polymerase ECF-subfamily sigma factor
  • ... more
Streptomyces viridochromogenes DSM 40736 ECF38 ECF38s2

>ECFp27083 ECF38 ECF38s2 Streptomyces viridochromogenes DSM 40736

1 MGTVVDDAASVEFHAFFERHYAELSRLAYLLTGESDTADDLAADALLALW
51 HRWDRVRAADHPAAYARGVVANLARTRIRSAVRERRRIALFWSQREENTE
101 NPDVAGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGTPGVPQRMHAALGAPRCSPAVEGVRTGEGGGRDR

>ECFp27095 ECF38 ECF38s2 Streptomyces

1 MGTLIDDTASVEFHAFFERHYAELSRLAALLTGEADAADDLAADALLALW
51 HRWDRVRAADHPVAYARGVVANLARTRIRSAVRERRRVALFWSQREERVE
101 NPDVAGVVDVREALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGTPEVPRRVHAAVGRPGKPAGEDTGRDG

Name Aliases LCA Taxa Group Subgroup
ECFp27111
  • RNA polymerase sigma factor
  • RNA polymerase subunit sigma
  • ... more
Nocardioides luteus ECF38 ECF38s2

>ECFp27111 ECF38 ECF38s2 Nocardioides luteus

1 MLADDASAEFHDFFERHYAELARLAHLLTGEKDAADDLAADALVALWQRW
51 DRLRAAQHPVAYARGVVANLARERIRSSVRERRRVALFWSLGAEHVNGPD
101 VAVVQDVRAALTRLPFRKRACVVMRHALDLSEKDTAAALGISVGTVKSQT
151 SKGMAELERLLGADTVGELATGGRNR

>ECFp27126 ECF38 ECF38s2 Streptacidiphilus neutrinimicus

1 MLPDDASVDFHDFFERHYAELARFAHLLTGEADAADDLAADALVAIWQNW
51 DRFRAAQSPRAYARGVVANMARERVRSTVRERRRITLFWSRVPERTDGPD
101 VAAVLDVRTALTRLPFRRRACVVLRHAFDLSEKDTAMALGISVGTVKSQT
151 SKGLAELERILGVRSAELLVAGRRVP

>ECFp27109 ECF38 ECF38s2 Streptomyces antibioticus

1 MGTVVDDAASAEFHAFFERHYAELSRLAHLLTGESDAADDLAADALLALW
51 QRWDRVRAADHPVAYARGVLANLARTRIRSTVRERRRIALFWSQREEKTE
101 NPDIAGVVDVQDALRRLPFRRRACVVLRHAFDLSEKDTALALGITVGTVK
151 SQTSKGMAELQRLLGSAGVPRKVHVAMARGGETVGRKR

Name Aliases LCA Taxa Group Subgroup
ECFp27130
  • hypothetical protein
  • DZ96_RS49630
Actinomadura madurae LIID-AJ290 ECF38 ECF38s2

>ECFp27130 ECF38 ECF38s2 Actinomadura madurae LIID-AJ290

1 MNGSRRALWERSPDAARSEFHGFFERHHRELARLAYLLLGDPDGADDLAA
51 DALAAAWQRWDRVRAADQPLAYVRRMVVNMSRSRIRALVRERDTLERMRA
101 VAGEHVPPPDVPAAVDVRAALRRLPQRKRACVVLRLAFDLSEKDTARCLG
151 VTVGTVKSQTAKGAAELVRQLADRPPERRGNLPDAAGD

Name Aliases LCA Taxa Group Subgroup
ECFp27117
Streptomyces galbus ECF38 ECF38s2

>ECFp27117 ECF38 ECF38s2 Streptomyces galbus

1 MGTVVDDAASVEFHAFFERHYAELSRLAHLLTGEADAADDLAADALLAMW
51 HRWDRVRAADHPVAYARGVVANLARTRIRSAVRERRRITLFWSQREEKTE
101 NPDVAGVVDVQSALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQKLLGTENAPNRMHAGITGAGVTEARVTGAGVSGTGGRDR

>ECFp27119 ECF38 ECF38s2 Streptomyces globisporus subsp. globisporus

1 MTADAGAEDSATEFRAFFERHYAELARLAHLLTGETDAADDVAADAMLAL
51 WNRWDRVRAADHPAAYARGVVANLVRTRIRGAVRERRRIAAFWDRRPEHT
101 EDPDVPAVVDVRTALRALPFRKRACVVLRHAFDLSERDTALALGVSVGTV
151 KSQTAKGMAELQRLLGDRAATELAAGRR

>ECFp27124 ECF38 ECF38s2 Streptomyces sp. NRRL S-37

1 MGTVVDDAASVEFHAFFERHYAELSRLAHLLTGEADAADDLAADALLALW
51 HRWDRVRAADHPVAYARGVVANLARTRIRSAVRERRRIALFWSPREERTE
101 NPDVPGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGTREVPRQVHAAVAAAAGGEAAGDARKRPTGARGRN
201 R

Name Aliases LCA Taxa Group Subgroup
ECFp79379
  • RNA polymerase sigma factor
  • putative RNA polymerase ECF-subfamily sigma factor
  • ... more
Actinoplanes missouriensis 431 ECF38 ECF38s2

>ECFp79379 ECF38 ECF38s2 Actinoplanes missouriensis 431

1 MRDDAFRAYFERHHASLSRLAFLMTGESDVADDLAADALTECWRHWDRVT
51 AADDPAAYGHGILMNLARNWVRRRGRERLLSFESLRRTRESDVSAVLDVR
101 GALRRLPHRRRACVVLRYAFDLPEREVATILGISVGAVKSATSRGAKQLA
151 DLLGDGGVARIDGWEAAR

>ECFp79620 ECF38 ECF38s2 Actinoplanes subtropicus

1 MTDPGSAFGRFFEEHHADLSRLAFLLTGESGAADDLAADAFVEVWRHWPR
51 VQAADSPVAYARGIVANLARQWIKKQARDRAGVLGLGLLRRDTTEPDTLA
101 VLDVRAALRRLPQRRRECVVLRYGFDVPEREVAEILGISVGAVKSMTSRG
151 AAQLSTYLEDLTVATGGGRRATAG

Name Aliases LCA Taxa Group Subgroup
ECFp79685
  • RNA polymerase sigma factor
  • L083_4353
  • ... more
Actinoplanes sp. N902-109 ECF38 ECF38s2

>ECFp79685 ECF38 ECF38s2 Actinoplanes sp. N902-109

1 MSEDRVADADVERAFRRFFDEHHADLSRLAYLVTGDAGIADDLAADAFTE
51 VWKHWARVEAADSPLAYARGILTNLARQWIKRQTRERHGLLRLGLLRRDR
101 SEPDTPAVLDVRAALDKLPVRRRECVILRYAFDVPEREVAEILGISVGAV
151 KSHTSRGAAQLSTFLQDIPLSAGGGRHA

>ECFp88221 ECF38 ECF38s2 Actinoplanes awajinensis subsp. mycoplanecinus

1 MPEQDAERAFRRFFDAHHTDLSRLAYLVTGETQVADDLASDAFVEVWRHW
51 ERVQAADSPIAYARGIVTNLARQWIKKQTRERAGLLRLGLLRRDRGETDT
101 PAILDVRAALGRLPLRRRECVILRYAFDVPEKEVAAILGISVGAVKSHSS
151 RGAAQLSEFLREMPLMMGGHHG

>ECFp89018 ECF38 ECF38s2 Actinoplanes awajinensis subsp. mycoplanecinus

1 MRDDAFRAYFERHHASLSRLAFLMTGEAQVADDLAADALTEVWRHWDRVQ
51 AADDPAAYGHGIVMNLARAWVRRRGRERLLTLGLSGRAPAGSDVPAVLDV
101 RSALRKLPHRRRACVVLRYAFDMSERDVAATLGISVGAVKSATSRGAKQL
151 ADLLGGAVTRIDGWEAAR

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more