ECF proteins of ECF subgroup ECF38s2

Displaying ECF 301 - 320 of 393 in total

>ECFp27006 ECF38 ECF38s2 Streptomyces sp. DSM 15324

1 MVLDDASAEFHEFFERHYAELARLAHLLTGEADAADDLAADALVALWQRW
51 DRLRQADHPVAYARGVVANLARGRIRSAVRERRRITLFWSRSPEKVEGPD
101 SAAVLDVRAALARLPFRKRACVVLRHALDLSEKDTAAALGISVGTVKSQT
151 SKGMAELQKILGARAAGDLVAGRRKR

>ECFp27017 ECF38 ECF38s2 Streptomyces puniciscabiei

1 MVLDDASAEFHEFFERHYAELARLAHLLTGETDAADDLAADALVALWQRW
51 DRLRQADHPLAYARGVVANMARGRIRSAVRERLRITLFWSRIPEKVEGPD
101 MAAVLDVRAALARLPFRKRACVVLRHAFDLSEKDTAAALGISVGTVKSQT
151 SKGMAELERILGARAVGDLVAGRRNR

Name Aliases LCA Taxa Group Subgroup
ECFp27004
  • RNA polymerase sigma factor
  • G412_RS0114020
Streptomyces flavidovirens DSM 40150 ECF38 ECF38s2

>ECFp27004 ECF38 ECF38s2 Streptomyces flavidovirens DSM 40150

1 MDAGAPDAAVEFHDFFERHHAGLARLAHLLTGDADAADDLAADALVALWH
51 RWDRVRAADHPAAYARGVVANLARSRIRSAVRERRRVALCWPHRVEYTDG
101 PDIPAVVDVQQALRTLPFRKRACVVLRHAFDLSERDTALALGISVGTVKS
151 QTSRGVAQLEKLLGSDTAAELVGERY

Name Aliases LCA Taxa Group Subgroup
ECFp27018
  • RNA polymerase subunit sigma
  • AQI70_00535
  • ... more
Streptomyces curacoi ECF38 ECF38s2

>ECFp27018 ECF38 ECF38s2 Streptomyces curacoi

1 MGTVVDDAASVEFHAFFERHYAELSRLAHLLTGEADAADDLAADALLALW
51 HRWDRVRAADHPVAYARGVVANLARTRIRSAVRERRRIALFWSQREEKTE
101 NPDVAGVVDVQAALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGTQGAPLKVHAAAMARTGNAGGRNR

>ECFp27024 ECF38 ECF38s2 Streptomyces sp. NRRL S-118

1 MGTVVDDAASVEFHAFFERHYAELARLAHLLTGEADAADDLAADALLALW
51 HRWDRVRASEHPVAYARGVVANLARTRIRSAVRERRRIALFWAHGEEKAE
101 NPDVAGVVDVQGALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGTQDAPRKVHAAMARTGTAGGRDR

>ECFp27005 ECF38 ECF38s2 Actinomadura kijaniata NBRC 14229

1 MSPEDEASRAEFHRFFERHHRELARLAYLMLGDPDAADDLAADALADAWH
51 RWDRVRAADQPLAYVRRMVVNMCHSRVRTLVRDRGRFAALAARWRERADA
101 PDVPAVVDVRSALQRLPERKRACVVLRLAFDLSEQETARVLGVSVGTVKS
151 QTSRGVAELVRMLGGRDDPAVAGAALRTERPGMGA

>ECFp26999 ECF38 ECF38s2 Streptomyces prasinopilosus

1 MGTLIDDAASVEFHAFFERHYAELSRLAALLTGEPDAADDLAADALLALW
51 HRWDRVRAADHPVAYARGVVANLARTRIRSAVRERRRVALFWSQREERVE
101 NPDVAGVVDVREALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGTAEVPRRMHATVGRPGKPAGEDTGRDG

>ECFp27010 ECF38 ECF38s2 Streptomyces exfoliatus DSM 41693

1 MVTADADADDSATEFRAFFARHYAELARLAHLLTGETDAADDLAADAMLA
51 LWHRWDRVRAADHPAAYARGVVANLVRTRIRGTVRERRRIAAFWDRRPDH
101 VEDPDVPAVIDVRTALRALPFRKRACVVLRHAFDLSERDTALALGISVGT
151 VKSQTAKGMAELQRLLGDRAVTELVSGRR

>ECFp27012 ECF38 ECF38s2 Streptomyces sp. NRRL B-24720

1 MGTVVDDAAAAEFHEFFEAHYAELARLAHLLTGEADAADDLAADALLALW
51 HRWDRVRNADRPVAFARGVVANLARTRIRSAVRERRRIALFWAPRGGGDG
101 YAVDDPDVSTVVDVQGALRRLPFRKRACVVLRHAFDLSERDTALALGISV
151 GTVKSQTSRAVAELQRLLGPDTPAARVQVAVAAQRGGGRH

>ECFp27032 ECF38 ECF38s2 Streptomyces torulosus

1 MGTVVDDAASVEFHDFFERHYAELSRLAHLLTGEADAADDLAADALLAMW
51 HRWDRVRAAEHPVAYARGVVANLARTRIRSAVRERRRITLFWSQREEKTE
101 NPDVPGAVDMQSALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELRKLLGTGDAPKRMPAGISGAGVTGARVTGAGAPGSGRRDR

Name Aliases LCA Taxa Group Subgroup
ECFp27033
Streptomyces roseus ECF38 ECF38s2

>ECFp27033 ECF38 ECF38s2 Streptomyces roseus

1 MATIVDDAASVEFHAFFERHHAELARLAHLLTGEADAADDLAADALLALW
51 HRWDRLRASEQPVAYARGVVANLARARIRSAVRERRRVALFWAQREEKTE
101 NPDVAGAVDVRRALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGAQDAPRKVHAAMARTGTAGGRDR

Name Aliases LCA Taxa Group Subgroup
ECFp27036
Streptomyces niger ECF38 ECF38s2

>ECFp27036 ECF38 ECF38s2 Streptomyces niger

1 MAAPVDAATEFRAFFEAHYAELGRLARLLTGDTEGADDLAADALVALWHR
51 WDRVRAADHPAAYARGVVANLARSHIRSAIRERRRIALFWAQCSEHADAP
101 DVPAVVDVQQALRTLPFRKRACVVLRHAFDLSERETALALGISVGTVKSQ
151 TSKGMAQLERLLGARAAGELVGRRT

Name Aliases LCA Taxa Group Subgroup
ECFp27053
  • hypothetical protein
  • BS75_RS32335
Streptacidiphilus albus ECF38 ECF38s2

>ECFp27053 ECF38 ECF38s2 Streptacidiphilus albus

1 MPMAVTTLGAKDEAARQAFGAFFSAHHRGLGRLAYLLSGDQDAAEDITAE
51 AFAEAWRCWKQVTQADSPVAYVRRIVVNLAANRIRGLTRERNSRRLLGAA
101 WSDRSNGPDVAAVTDVRAALMKLPARKRACVVLRHYYGLSEQDTAQTLGI
151 SVGTVKSQTSRGVAELAALLDTGTEGKRRRGSRG

>ECFp27037 ECF38 ECF38s2 Streptomyces afghaniensis 772

1 MGTVVDDAASVEFHAFFERHYAELSRLAYLLTGESDTADDLAADALLALW
51 HRWDRVRAADHPAAYARGVVTNLARTRIRSAVRERRRIALFWSQREENIE
101 NPDVAGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGTQGVPQRMHAAVGAPRCSPAVEGLRARTGEGGGRD
201 R

>ECFp27072 ECF38 ECF38s2 Streptomyces puniciscabiei

1 MLLDDASAEFHEFFERHYAELARLAHLLTGETDAADDLAADALVALWQRW
51 DRLRQADHPLAYARGVVANLARGRIRSAVRERLRITLFWSRIPEKVEGPD
101 MAAVLDVRSALARLPFRKRACVVLRHAFDLSEKDTAAALGISVGTVKSQT
151 SKGMAELERILGARAVGDLVAGRRNR

>ECFp27055 ECF38 ECF38s2 Actinobacteria bacterium OK006

1 MGTVVDDAASVEFHAFFERHHAELARFAHLLTGEADAADDLAADALLALW
51 HRWDRVRAADHPVAYARGVVANLARTRIRSAVRERRRITLFWSQREDKTE
101 NPDIAGKIDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELKRLLGTEEASMRVHAGVLPTGGAGGRDR

Name Aliases LCA Taxa Group Subgroup
ECFp27060
Streptomyces pactum ECF38 ECF38s2

>ECFp27060 ECF38 ECF38s2 Streptomyces pactum

1 MGTVVDDAASVEFHAFFERHYAELSRLAHLLTGEPDAADDLAADALLALW
51 HRWDRVRAADHPAAYARGVVANLARTRVRTAVRERRRIALFWSQREERTE
101 NPDVAGVVDVREALRGLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGTQAAPKQVHAAIARSGEAAGRNR

Name Aliases LCA Taxa Group Subgroup
ECFp27059
  • RNA polymerase sigma factor
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Thermomonospora curvata DSM 43183 ECF38 ECF38s2

>ECFp27059 ECF38 ECF38s2 Thermomonospora curvata DSM 43183

1 MSSQGSLDEAARAEFQRFFELHHRELARLAALMLGDADAADDLTADALVA
51 AWHRWDRVRNADQPLAYVRRMVINMCNSRIRTLMRERGGLHVLEGGERES
101 RQDPDVAAIVDVRAALRRLPPRKRACVVLRLAFDLSEQETARVLGVSVGT
151 VKSQTSRGVAELVRALRERPEGPAAGLLRGGAAGGPLGEGA

>ECFp27066 ECF38 ECF38s2 Streptomyces sp. NRRL F-5727

1 MTVTDPPGEGDSAAEFRDFFDRHYAELARLAHLLTGETDAADDLAADAML
51 ALWHRWDRVRAAEHPAAYARGVVANLVRTRIRGTVRERRRIAAFWDRRPE
101 HTEDPDVPAVVDVRTALRALPFRKRACVVLRHAFDLSERDTALALGVSVG
151 TVKSQTAKGMAELQRLLGARAATELAAGRR

>ECFp27074 ECF38 ECF38s2 Streptomyces prasinopilosus

1 MGTLIDDAASVEFHAFFERHYAELSRLAALLTGEADAADDLAADALLALW
51 HRWDRVRAADHPVAYARGVVANLARTRIRSAVRERRRVALFWSQREERVE
101 NPDVAGVVDVREALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGTAEVPRRMHATVGRPGKPAGEDTGRDG

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more