ECF proteins of ECF subgroup ECF38s2

Displaying ECF 281 - 300 of 393 in total
Name Aliases LCA Taxa Group Subgroup
ECFp26930
  • RNA polymerase sigma factor
  • IO36_RS28050
Streptomyces aureus ECF38 ECF38s2

>ECFp26930 ECF38 ECF38s2 Streptomyces aureus

1 MGTVVDDAASVEFHAFFERHHAELARFARLLTGEPDAADDLAADALLALW
51 HRWDRVRSAEHPAAYARGVVANLARTRIRAAVRERRRITLFWSQREDRTE
101 NPDVAGTVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGISVGTVK
151 SQTSKGMAELKRLLGTDEASVRMHAGAFPAGGAAGGRDR

Name Aliases LCA Taxa Group Subgroup
ECFp26932
  • RNA polymerase sigma-E factor
  • sigE_1
  • ... more
Streptomyces rubrolavendulae ECF38 ECF38s2

>ECFp26932 ECF38 ECF38s2 Streptomyces rubrolavendulae

1 MGTSADDATAEFHAFFERHHAELARLAHLLTGDADAADDLAADALLALWH
51 RWDRVRAAQHPAAYARGVVANLARSRVRSAVRERRRVALFWSQRSEHTEG
101 PDVAAVVDVRDALRRLPFRKRACVVLRHAFDLSERETALTLGVSVGTVKS
151 QTSKAMAQLQQLLGTRDAASELVGGRN

>ECFp26935 ECF38 ECF38s2 Streptomyces sp. CNH099

1 MGTPSAGHDAAATAEFREFFEHHYAELARLANSLSGESDGADDLAADALV
51 ALWRRWDRVRATDHPAAYARGVVANLVRSRIRSAVRERRRLALYWTDNHE
101 HVDDPDVPAVVDVRAALRSLTFRKRACVVLRHAFDLSERETAHTLGISVG
151 TVKSQTAKGVAQLEQALGGGAQPAPGRVRRA

Name Aliases LCA Taxa Group Subgroup
ECFp26968
Frankia torreyi ECF38 ECF38s2

>ECFp26968 ECF38 ECF38s2 Frankia torreyi

1 MEAVAADDEHEHPHRQAEFHAFFESHHRALSRFAYLLTGDHDAADDLTAE
51 ALTAAWSSWDRVRSAELPLAYVRRIVANLAADRVRKVVRERRGLAVLGQR
101 AERSAPVPDVPAVVDLRTALMSLPSGKRACVVLRYAFDLSEGETARTLGI
151 SVGTVKSQTAKGVAELERILKRAEPPPTATTQEEVTPRMAPEHPETPQGG
201 TSRPGTSRMNGARSGSGDSPGGRGAGQSDEPAGPDRSAFAPPRGTEPTPG
251 TGLTRGTGLTAAPDLAPGAGPTPGSGRHPHGEPFPETGRLPGPVPLARRE
301 PLRREPVPWRGSASGRQPLSRHERVPGPERVPGPERVPGPERVPGPERLS
351 PTERMPQAERMPPTEHVARLDEPGWLERPRGAGSPTWPESLPWSRLAWPE
401 RLAWPVWRVGEA

>ECFp26947 ECF38 ECF38s2 Streptacidiphilus carbonis

1 MLLDDTSAEFHAFFERHYTELARFAHLLTGESEAADDLASDALVSLWQRW
51 DRMRSADQPLAYARGVVANMARERIRSAVRERRRVALFWSRNPEQADLPD
101 LAAVLDVRAALVRLPFRKRACVVLRHALDLSEKETAAALGISVGTVKSQT
151 SKGLAELEGILGARAAGAFAAGRRNR

>ECFp26959 ECF38 ECF38s2 Streptomyces sp. NRRL F-6131

1 MLLDDTSAEFHEFFDRHYAELARFAHLLTGEADAADDLAADALVALWQRW
51 DRLRSADHPLAYARGVVANMARARIRSAVRERRRVLLFWTRCPERTDGPD
101 VAAVLDVRAALARLPFRKRACVVLRHAFDLSEKDTAVALGISVGTVKSQT
151 SKGMAELERALGARAVGELAAGRRNR

>ECFp26945 ECF38 ECF38s2 Streptomyces graminilatus

1 MGTVVDDAASVEFHAFFDRHYAELARLAHLLTGEADAADDLAADALLALW
51 NRWDRVRAADHPVAYARGVVANLAKTRIRSAVRERRRITLFWSQREEKTE
101 NPDIPGVIDVQTALRRLPFRKRACVVLRHAFDLSEKDTALALGVTVGTVK
151 SQTSKGMAELKRLLGGDEAPLRVRTPVRTTGGAGGTNR

>ECFp26956 ECF38 ECF38s2 Streptomyces sp. MMG1533

1 MGTVVDDAASVEFHAFFERHYAELSRLAHLLTGEADAADDLAADALLALW
51 HRWDRVRAADHPAAYARGVVANLARTRIRSAVRERRRIALFWSQREEKIE
101 NPDVAGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALTLGVSVGTVK
151 SQTSKGMAELQRLLGTQAAPLRVHAAMVRTGDAAGRDR

>ECFp26962 ECF38 ECF38s2 Streptomyces sviceus ATCC 29083

1 MGTVVDDAASVEFHAFFERHYAELSRLAHLLTGEPDAADDLAADALLALW
51 HRWDRVRAADHPVAYARGVVANLARTRIRSAVRERRRVALFWSQREEKAE
101 NPDVAGAVDVQEALRRLPFRKRACVVLRHAFDLSEKETALALGVSVGTVK
151 SQTSKGMAELQRLLGPQNAPQKVRATMARTGDAGGRDR

>ECFp26951 ECF38 ECF38s2 Streptomyces sp. NRRL F-5650

1 MGTVVDDAASAEFHAFFERHYAELARLAHLLTGEPDAADDLAADALLALW
51 HRWDRVRAADHPVAYARGVVANLARTRVRAAVRERRRVALFWSQREERTE
101 NPDVAGAVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGVAELQRLLGTRAVPRAPRQVHAAIARSGRAAGGAR

>ECFp26952 ECF38 ECF38s2 Streptomyces venezuelae

1 MDADTDDSATEFRAFFARHYAELARLAHLLTGETDAADDLAADAMLALWH
51 RWDRVRAADHPAAYARGVVTNLVRTRIRGTVRERRRIAAFWDRRPDHVED
101 PDVPAVLDVRTALRSLPFRKRACVVLRHAFDLSERDTALALGISVGTVKS
151 QTAKGMAELQRLLGDRAATELVAGRR

Name Aliases LCA Taxa Group Subgroup
ECFp26969
  • RNA polymerase subunit sigma-24
  • putative sigma factor
  • ... more
Streptomyces bingchenggensis BCW-1 ECF38 ECF38s2

>ECFp26969 ECF38 ECF38s2 Streptomyces bingchenggensis BCW-1

1 MSAPTDDPAAVRPAPAALPESPENAPPATAGRSPLPDLPAAALSDLPPVE
51 ASDPAPEQTPIPTADLAPAGPPDVQEEFRDFFERHHAELARLAHLLLGSS
101 DGADDLAADALVAVWHQWERVRVADHPAAYARGVVANLARSRIRSLVRER
151 RRVALFSSQRADHVDDPDVSAVVDVQAALVRLPFRKRACVVLRHAFDLSE
201 RETARTLGISVGTVKSQTSRGIAELERLLGSAHGGGQQPVPGPQETVRKL
251 HPGHAGGNGR

>ECFp26972 ECF38 ECF38s2 Streptomyces antibioticus

1 MVLDDASAEFHEFFERHYAELARLAHLLTGEADAADDLAADALVALWQRW
51 DRLRQADHPLAYARGVVANMARGRIRSTVRERRRITLFWSRSPEKVEGPD
101 TAAVLDVRSALARLPYRKRACVVLRHAMDLSEKETAAALGISVGTVKSQT
151 SKGMAELQKLLGARAAQDLVPGRRKR

>ECFp26992 ECF38 ECF38s2 Streptomyces sp. NRRL F-2580

1 MVLDDASAEFHHFFERHYAELARFAHLLTGEADGADDLAADALIALWQRW
51 DRLRQAEYPLAYARGVVANLARSRIRSAVRERRRIALFWSRGAEPLDGPD
101 VAAVVDVRTALDRLPFRKRACVVLRHAFDLSEKDTALALGISVGTVKSQT
151 SKGMAELERMLGSTGAAGELLAGRRSR

>ECFp26978 ECF38 ECF38s2 Streptomyces lavenduligriseus

1 MGTVVDDAASVEFHAFFERHYAELARLAHLLTGEADAADDLAADALLALW
51 HRWDRVRAADRPVAYARGVVANLARTRIRGAVRERRRIALFWPRGEERTE
101 NPDVAGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGISVGTVK
151 SQTSKGMAELQRLLGPQGDPRRVHAAMAARGGESGGRNR

>ECFp26980 ECF38 ECF38s2 Streptomyces sp. Root264

1 MGTVVDDAASVEFHAFFDRHYAELSRLACLLTGETDAADDLAADALLALW
51 NRWDRVRAADHPVAYARGVVANLARTRIRSAVRERRRIALFWSQREEKTE
101 NPDVAGVVDVQSALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGGKSAPLRVPAMARDRQAAGRDR

Name Aliases LCA Taxa Group Subgroup
ECFp26983
  • RNA polymerase sigma factor
  • OO67_RS34345
Streptomyces atroolivaceus ECF38 ECF38s2

>ECFp26983 ECF38 ECF38s2 Streptomyces atroolivaceus

1 MGTVLDDAAAAEFHAFFEAHYAELARLAHLLTGEADAADDLAADALMALW
51 HRWDRVRGADHPAAYARGVVANLARTRIRSAVRERRRIALFWAPRGAGDG
101 YAADGPDVSAVVDVQGALRRLPFRKRACVVLRHAFDLSERDTALVLGVSV
151 GTVKSQTSRGVAELQRLLGPEAPAVRVQVAAAGQRTGGRQ

>ECFp26979 ECF38 ECF38s2 Streptomyces sp. SPMA113

1 MDTTHTTDPPRAAAPEAPDAPEGPDGLSADAHPDLPAGSPATGHPDPPAA
51 PHADLQTAAPHPDPPDPQAEFRDFFERHHTELARLAHLLLGSSDGADDLA
101 ADALVAVWHQWDRVRAADHPAAYARGVVANLARSRIRSLVRERRRVALFS
151 SQRSDHVDDPDVSAVVDVQAALVRLPFRKRACVVLRHAFDLSERETARTL
201 GISVGTVKSQTSRGIAELERLLGPPDGEGELPGATDAGRTVRTLRSGNTG
251 PTGTGPTGTGPTGTGPTGPARHSGQMGHAGHAGGGS

Name Aliases LCA Taxa Group Subgroup
ECFp27015
  • hypothetical protein
  • B056_RS0133740
Frankia discariae ECF38 ECF38s2

>ECFp27015 ECF38 ECF38s2 Frankia discariae

1 MDSAADVGVHTPRLPTGRTRPPRLDQSVGAHRGRTPHWFPDPMATSMSTD
51 AAAGSGAAPAQRPGSDDGFTGSEGRLPGRHPDPDEVGPSLEDPGPVPVGA
101 VALEAAGCPGPPPNARVEFREFFEHHHRELARFAYLLTGDHDAADDLTAE
151 ALTAAWSKWDRVSSADSPLAYVRRIVANLATSRLRRVIRERRGMTVLGML
201 AEHTEHAPDDTDVPAAVDLRAALMTLPARKRACVVLRYAFDLSEADTART
251 LGISVGTVKSQTSKAVAELERALGTRPELTHSDPPDDTSARKQDARPPAP
301 QTPRRAGATRGRRRATGGTDPASVARSALNRLRDSEAPGRLRGSEG

>ECFp27002 ECF38 ECF38s2 Streptomyces

1 MLLDDASAEFHEFFERHYAELARLAHLLTGETDAADDLAADALVALWQQW
51 DRLRLADHPLAYARGVVANLARGRIRSAVRERRRITLFWSRSPEKVDGPD
101 TAAVLDVRAALARLPYRKRACVVLRHALDLSEKETAAALGISVGTVKSQT
151 SKGMAELQKLLGAHAAENLVPGRRNR

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more