ECF proteins of ECF subgroup ECF38s2

Displaying ECF 241 - 260 of 393 in total

>ECFp26790 ECF38 ECF38s2 Streptomyces viridosporus T7A

1 MGTVVDDTASVEFHAFFERHYAELSRLAHLLTGEADTADDLAADALLALW
51 HRWDRVRAADHPVAYARGVVANLARTRIRGAVRERRRIALFWSQREERTE
101 NPDVAGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGTREVPQRVHAAVGTAARGDTAAGVRKRSGGAEGRD
201 R

>ECFp26795 ECF38 ECF38s2 Streptomyces sp. NRRL S-475

1 MGTVVDDAASVEFHAFFERHYAELSRLAYLLTGESDTADDLAADALLAMW
51 HRWDRVRAADHPAAYARGVVTNLARTRIRSAVRERRRIALFWSQREENTE
101 NPDVAGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGTRGVPQRMHATLGAPRVSPAVEGVRTGQGGGRDR

Name Aliases LCA Taxa Group Subgroup
ECFp26809
  • RNA polymerase sigma factor
  • BS83_RS20640
Streptacidiphilus rugosus AM-16 ECF38 ECF38s2

>ECFp26809 ECF38 ECF38s2 Streptacidiphilus rugosus AM-16

1 MVLRDGAAESAYQAFFERHHAELSRLAYLLTGEPDAADDLAADALLEVWR
51 HWDRVCAADSPAAYARGVLANLCRNRARRLGRERNGLRGWSTLWRENAHT
101 TDIPAVVDVRSALRRLPHRRRACVVLRFAFDLSERETAQALGISVGTVKS
151 QTSRGAAQLAELLGGRRPEAWLVSARQAGEGR

>ECFp26828 ECF38 ECF38s2 Streptomyces rubellomurinus

1 MLLDDASAEFHDFFERHYAELARLAHLLTGETDAADDLAADALVALWQRW
51 DRLRAADHPLAYARGVVANMARARIRSAVRERRRVLLFWSRSPERTSGPD
101 VAAVLDVREALARLPFRKRACVVLRHAFDLSEKDTAAALGISVGTVKSQT
151 SKGMAELERALGARAVGELATGRRNR

>ECFp26805 ECF38 ECF38s2 Streptomyces sp. 303MFCol5.2

1 MGTVVDDAASVEFHAFFDRHYAELSRLAHLLTGEADAADDLAADALLALW
51 NRWDRVRAADHPVAYARGVVANLARTRIRSAVRERRRIALFWSQREEKTE
101 NPDIAGVVDVQSALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQKLLGAKGTPLTMPAMVRTGEASASGRDR

>ECFp26808 ECF38 ECF38s2 Streptomyces sclerotialus

1 MEQPTGRPDAAVEFRAFFERYYAELARLARLLTGDTEGADDLAADALVAL
51 WHRWDRVRAADHPAAYARGVVANLARSHIRSAIRERRRIALFWAQCSEHA
101 DAPDVPAVVDVQQALRTLPFRKRACVVLRHAFDLSERETALALGISVGTV
151 KSQTSKGMAQLERLLGARAAGELVARRT

Name Aliases LCA Taxa Group Subgroup
ECFp26818
  • RNA polymerase subunit sigma
  • A4E84_09485
  • ... more
Streptomyces sp. S10(2016) ECF38 ECF38s2

>ECFp26818 ECF38 ECF38s2 Streptomyces sp. S10(2016)

1 MGTVVDDAASVEFHAFFERHYADLSRLAHLLTGESDTADDLAADALLALW
51 HRWDRVRAADHPVAYARGVVANLARTRIRSAVRERRRIALFWSQREENTE
101 NPDIAGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGTRAVPQRMHVALGAPHCSPAVEGVRTGEGGGRDR

Name Aliases LCA Taxa Group Subgroup
ECFp26856
Frankia sp. DC12 ECF38 ECF38s2

>ECFp26856 ECF38 ECF38s2 Frankia sp. DC12

1 MTATPSRPASRVFPPSGTTPGRAGTGALRPAAGPAQAEEFPEPPTADRHP
51 AGAGGRPAQAEFERFFEAHHRELARFAYLLSGDRDAAEDITAEALTSAWV
101 HWDRVQAADNPLAYVRRSVANLAAGRIRRTVRERNVLAKLGRQLPIQATN
151 GPDVPAVLDLESALLRLPLRKRQCVILRHGLDLSEAETADTLGISIGTVK
201 SQTSKAVSELERLLAAGGPGVPAANSAGASAAARKRPRIRRVALRGGEA

>ECFp26834 ECF38 ECF38s2 Streptomyces filamentosus

1 MADDASAEFHDFFDRHYAELARLAHLLTGEAAAADDLAADALVALWDRWD
51 RVRAAEHPVAYARGVVANMARGRVRAAVRERHRIALFWSRRGDRTEGPDL
101 AAVLDVRQALARLPFRKRACVVLRHAFDLSEKDTALALGISVGTVKSQTS
151 KGMAELERLLDGRTSLELAGRGER

>ECFp26850 ECF38 ECF38s2 Streptomyces sp. XY332

1 MVPDDASAEFHDFFERHYAGLARFAHLLTGESDGGDDLAADALIALWQRW
51 DRLRQAEYPLAYARGVVANLARSRIRSAVRERRRIALFWSRGVEPSDGPD
101 VASVVDVRTALARLPFRKRACVVLRHAFDLSEKDTALALGISVGTVKSQT
151 SKGMAELERMLGNTGASGELLTGRRSR

Name Aliases LCA Taxa Group Subgroup
ECFp26841
  • RNA polymerase ECF-subfamily sigma factor
  • BN159_3329
  • ... more
Streptomyces davaonensis JCM 4913 ECF38 ECF38s2

>ECFp26841 ECF38 ECF38s2 Streptomyces davaonensis JCM 4913

1 MLLDDASAEFHEFFERHYAELARLAHLLTGETDAADDLAADALVALWQRW
51 DRLRQADHPLAYARGVVANLARGRIRSTVRERRRITLFWSRSPEKVEGPD
101 MAAVLDVRAALARLPFRKRACVVLRHAFDLSEKDTAVALGISVGTVKSQT
151 SKGMAELVKLLGARAAGDLVAGRRNR

>ECFp26844 ECF38 ECF38s2 Streptomyces sp. NRRL S-350

1 MLLDDASAEFHDFFERHYAELARLAHLLTGEADAADDLAADALIALWQRW
51 DRLRAADHPLAYARGVVANMARARIRSAVRERRRVLLFWSRNPEKTEGPD
101 VAAVLDVRAALDRLPFRKRACVVLRHAFDLSEKDTAAALGISVGTVKSQT
151 SKGMAELERALGARAVGELTTGRRNR

Name Aliases LCA Taxa Group Subgroup
ECFp26846
  • RNA polymerase sigma factor
  • BR98_RS02960
Kitasatospora azatica KCTC 9699 ECF38 ECF38s2

>ECFp26846 ECF38 ECF38s2 Kitasatospora azatica KCTC 9699

1 MFLADTSAEFHDFFERHYAELARFANLLTGEPDAADDLAADAMIALWQRW
51 DRLRKADHPLAYARGVVANMARERIRAAMRERRRVSLFWFRGPGSVEGPD
101 TAAVLDVRTALARLPFRKRACVVLRHAFDLSEKETAAALGISVGTVKSQT
151 SRGMAELQGILGARAVGDLVTGRRKQ

>ECFp26833 ECF38 ECF38s2 Streptomyces glaucescens

1 MGTVVDDAASVEFHAFFERHYAELARLAHLLTGEADAADDIAADALLALW
51 HRWDRVRAADHPVAYARGVVANLARTRIRGAVRERRRIALFWSQREERTE
101 NPDVAGVVDVQDALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGIAELQRLLGTQQASRRVRAAMARTGQAAGRDR

>ECFp26851 ECF38 ECF38s2 Streptomyces

1 MGTVVDDAAAAEFRAFFEAHYAELARLAHLLTGEADAADDLAADALMALW
51 HRWDRVRGADHPAAYARGVVANLARTRIRSAVRERRRIALFWAPRGAGDG
101 GAADGPDVSAVVDVQEALRRLPFRKRACVVLRHAFDLSERDTALVLGVSV
151 GTVKSQTSRGVAELQRLLGPETPAAQVQVAAAGQRAGGRQ

Name Aliases LCA Taxa Group Subgroup
ECFp26854
  • RNA polymerase sigma factor
  • IH43_RS0135405
Streptomyces cellulosae ECF38 ECF38s2

>ECFp26854 ECF38 ECF38s2 Streptomyces cellulosae

1 MGTAVDDAASVEFHAFFERHYAELSRLAHLLTGEADAADDLAADALLALW
51 NRWDRVRAADHPAAYARGVVANLARTRIRSAVRERRRVALFWSQREERTE
101 NPDVAGVVDVQDALRRLPFRKRACVVLRHAFDLSEKDTALTLGVSVGTVK
151 SQTSKGMAELQRLLGTQAAPQKVHAAMARTGEAGGGDR

Name Aliases LCA Taxa Group Subgroup
ECFp26857
Streptomyces bicolor ECF38 ECF38s2

>ECFp26857 ECF38 ECF38s2 Streptomyces bicolor

1 MGTVVDDAASVEFHAFFDRHYAELSRLAHLLTGEADAADDLAADALLALW
51 HRWDRVRAADHPVAYARGVVANLARTRIRSAVRERRRIALFWSQREEKTE
101 NPDIAGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGISVGTVK
151 SQTSKGMAELQRSLGTQGAPLKVHAAAMARTGNAGGRNR

>ECFp26845 ECF38 ECF38s2 Streptomyces sp. NRRL B-1140

1 MGTVVDDAASVEFHAFFERHYAELSRLAHLLTGESDSADDLAADALLAMW
51 HRWDRVRAADHPAAYARGVVANLARTRIRSAVRERRRIALFWSQREENTE
101 NPDVAGVVDVREALRRLPFRKRACVVLRHAFDLSEKDTAQALGVSVGTVK
151 SQTSKGMAELQRLLGTQGVPQRMHATLGTPRCSPAVEGVRTGEGGGRDR

Name Aliases LCA Taxa Group Subgroup
ECFp26885
  • RNA polymerase sigma factor
  • AMIS_RS04900
Actinoplanes missouriensis 431 ECF38 ECF38s2

>ECFp26885 ECF38 ECF38s2 Actinoplanes missouriensis 431

1 MSEYETEYAFRRFFDDHHADLSRLAYLVTGDSQAADDLAADAFVEVWRHW
51 ERVQAAQSPIAYARGIVTNLARQWIKRQSRERAGILRLGLLRRERGESDT
101 PAVLDVRAALQRLPQRRRECVILRYAFDVPEKEVATILGISVGAVKSHTS
151 RGAAQLSEFLRGMPLMMGGLHG

Name Aliases LCA Taxa Group Subgroup
ECFp26883
  • RNA polymerase sigma factor
  • TR49_RS30375
Streptacidiphilus melanogenes ECF38 ECF38s2

>ECFp26883 ECF38 ECF38s2 Streptacidiphilus melanogenes

1 MTGWNPAAEQAYHAFFERHHAELSRLAYLLTGEPDAADDLAADALLEVWR
51 HWDRVSAADSPAAYARGVLANLCRNRARRLGRERRGWRALWNESAHTARG
101 TDVPAVVDVRGALRRLPYRRRACVVLRYAFDLSEKETAQALGISVGTVKS
151 QTSRGAAQLAALLRGVDGKPDGDADGWLVTVGEER

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more