ECF proteins of ECF subgroup ECF38s2

Displaying ECF 221 - 240 of 393 in total
Name Aliases LCA Taxa Group Subgroup
ECFp26734
  • RNA polymerase sigma factor
  • SCATT_RS32445
Streptomyces cattleya NRRL 8057 = DSM 46488 ECF38 ECF38s2

>ECFp26734 ECF38 ECF38s2 Streptomyces cattleya NRRL 8057 = DSM 46488

1 MLLDDASAEFHEFFERHYAELARLAHLLTGETDAADDLAADALVALWQRW
51 DRLRQAHHPLAYARGVVANLARGRIRSAVRERRRITLFWSRSPQTAEGPD
101 VADVLDVRAALARLPFRKRACVVLRHAFDLSEKDTAVALGISVGTVKSQT
151 SKGMAELERILGARAVGDLVAGRRNR

>ECFp26743 ECF38 ECF38s2 Saccharothrix sp. NRRL B-16348

1 MPPDDASAEFHAFFQRHHAELSRLGYLLTGEADAADDLAADALIALWQRW
51 DRLRQADHPLAYARGVVANLARERIRGAVRERRRIALFWSQRPQQAQDPD
101 VAAVVDVRAALDRLPFRKRACVVLRHAFDLSEKDTALALGISVGAVKSQT
151 SKGMAELARIVGAHAAGDVVAGRRSR

Name Aliases LCA Taxa Group Subgroup
ECFp26726
  • RNA polymerase sigma-E factor
  • RNA polymerase subunit sigma
  • ... more
Streptomyces ECF38 ECF38s2

>ECFp26726 ECF38 ECF38s2 Streptomyces

1 MGTVVDDAASVEFHAFFERHYAELARLAHLLTGEPDAADDLAADALLALW
51 HRWDRVRAADRPVAYARGVVANLARTRIRGAVRERRRIALFWPRGEERTE
101 NPDVAGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGISVGTVK
151 SQTSKGMAELHRLLGSQGDPRRVHAAMAARAGESGGRNR

>ECFp26730 ECF38 ECF38s2 Streptomyces sp. NRRL S-1521

1 MPSAADDAAAEFHAFFERHYAELARLAHLLTGETDGADDLAADALLALWH
51 RWDRVRAADHPAAYARGVVANMARSRIRSAVRERRRVTLFWSGRGEDVAD
101 PDIPAVVDVRDALRALPFRKRACVVLRHAFDLSEKDTAQALGISVGTVKS
151 QTSKGMAELQRRLGPQTAWERVRAVTADTGGST

Name Aliases LCA Taxa Group Subgroup
ECFp26732
Streptomyces luteus ECF38 ECF38s2

>ECFp26732 ECF38 ECF38s2 Streptomyces luteus

1 MGTVVDDAASVEFHAFFERHYAELARLAHLLTGEPDAADDLAADALLALW
51 HRWDRVRAADHPAAYARGVVANLARTRVRTAVRERRRIALFWSQREERTE
101 NPDVAGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGTQTAARQMHAAVARSGEAAGRNR

>ECFp26718 ECF38 ECF38s2 Streptomyces rimosus subsp. rimosus

1 MNTPRSAAPAGPAPATGDATAEFHAFFERHHAELARLAHLLTGEADAADD
51 LAADALLALWHRWDRVRGAEHPVAYARGVVANMARGRIRSTVRERRRIAL
101 FWSQRSERTDGPDVAAVVDVRQALERLPFRKRACVVLRHAFDLSERDTAL
151 TLGVSVGTVKSQTSRGMAELQRHLGTGAADDLSGRGK

>ECFp26744 ECF38 ECF38s2 Streptomyces bottropensis ATCC 25435

1 MGTVVDDAASVEFHAFFERHYAELSRLAHLLTGEADAADDLAADALLAMW
51 HRWDRVRAADHPVAYARGVVANLARTRIRSAVRERRRITLFWSQREEKTE
101 NPDVPGVVDVQSALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQKLLGTENAPRRMHAGITGGGARGASVTGAGAPGSGGRDR

Name Aliases LCA Taxa Group Subgroup
ECFp26724
  • RNA polymerase subunit sigma
  • YWW_RS31735
Glycomyces tenuis ECF38 ECF38s2

>ECFp26724 ECF38 ECF38s2 Glycomyces tenuis

1 MDVPAPREEAAFRAFFERHHAELARFAWLLLGERAAAEDLAADAMLAVWR
51 QWGRVERSSSEIAYARGIVANLAKSRIRSAVRERRRNALFWLRPGEAASE
101 PNIAAVVDVRRALARLPFRKRACVVLRHSLGLSELETAEALGVSVGTVKS
151 QTSKGLAELRKILGPPTGGRGGSAWGSIPNGVGQ

Name Aliases LCA Taxa Group Subgroup
ECFp26770
  • RNA polymerase sigma factor
  • WH85_RS14160
Actinoplanes rectilineatus ECF38 ECF38s2

>ECFp26770 ECF38 ECF38s2 Actinoplanes rectilineatus

1 MPDFDAEDAERAFRRFFDDHHADLSRLAYLVTGDSQVADDLAADAFVEVW
51 RHWARVQAADSPVAYARGIVANLARQWIKRQTRERSGLLRLGLLRRDRDE
101 SDTPAILDVRSALRRLPLRRRECVILRYAFDLPEKEVAAILGISVGAVKS
151 HTSRGAAQLSEFLRGMPMMTGGGLRG

Name Aliases LCA Taxa Group Subgroup
ECFp26748
  • RNA polymerase sigma factor
  • ON12_RS09715
Streptomyces acidiscabies ECF38 ECF38s2

>ECFp26748 ECF38 ECF38s2 Streptomyces acidiscabies

1 MVLDDASVEFHEFFERHYAELARLAHLLTGEADAADDLAADALVALWQRW
51 DRLRQADHPLAYARGVVANLARGRVRSAVRERRRITLFWSRSPEKVDGPD
101 AAAVLDVRAALARLPYRKRACVVLRHALDLSEKETAAALGISVGTVKSQT
151 SKGMAELKKLLGAHAAGDLVQGRRNR

>ECFp26750 ECF38 ECF38s2 Streptomyces

1 MTEDEAAAEFHAFFERHHAGLSRLAYLLTGDADAADDLAADAMVALWHRW
51 DRARHADSAAAYARGIVANLARSRIRSTVRERRRVLLFWSHRPERTDGPD
101 LAAVMDVRAALDTLPFRKRACVVLRYAFDLSEKDTAAALGISVGTVKSQT
151 SKGTAELQRLLGTRAAGELVGGGSR

Name Aliases LCA Taxa Group Subgroup
ECFp26766
  • RNA polymerase sigma factor
  • B072_RS0128515
Streptomyces sp. HmicA12 ECF38 ECF38s2

>ECFp26766 ECF38 ECF38s2 Streptomyces sp. HmicA12

1 MSTVVDAEDGTASAEFHAFFERHHAELARLAHLLTGEPDAADDLAADALL
51 ALWHRWDRVRAAEHPVAYARGVVANLARTRIRSAVRERRRVALFWSGRQE
101 RTEGPDVPAVVDVQGALRELPFRKRACVVLRHAFDLSEKDTALALGISVG
151 TVKSQTSKGMAELERRLGQDALNTSAPRRVRAVGARALDATEGGRR

Name Aliases LCA Taxa Group Subgroup
ECFp26768
  • RNA polymerase sigma factor
  • AA958_30910
  • ... more
Streptomyces sp. CNQ-509 ECF38 ECF38s2

>ECFp26768 ECF38 ECF38s2 Streptomyces sp. CNQ-509

1 MGIPSAGHDAAATAEFREFFEHHYAELTRLANSLSGEAEGADDVAADALA
51 ALWHRWDRVRAADHPAAYARGVVANLVRSRIRSAVRERRRLALYWTGGHE
101 HAEGPDVPAVVDVRDALRGLTFRKRACVVLRHAFDLSERETAHTLGISVG
151 TVKSQTAKGVAQLEAALAGGAQPPSGRVRRA

>ECFp26776 ECF38 ECF38s2 Streptomyces sp. WM6386

1 MGTVVDDAASVEFHAFFERHYAELSRLAHLLTGESDAADDLAADALLALW
51 NRWDRVRAADHPAAYARGVVANLARTRIRSAVRERRRIALFWSQREEKTE
101 NPDIAGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGSQGVPRKMAAAMARGGESGGRTR

>ECFp26754 ECF38 ECF38s2 Streptomyces

1 MGTLIDDAASVEFHAFFERHYAELSRLAVLLTGEADTADDLAADALLALW
51 HRWDRVRAADHPAAYARGVVANLARTRIRSAVRERRRIALFWSQREERVE
101 NPDVAGVVDVREALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGTAEVPRRVHAAAGRPGRPAGEDTERDR

Name Aliases LCA Taxa Group Subgroup
ECFp26759
  • RNA polymerase sigma-70 factor, sigma-E family
  • STRIP9103_01989
  • ... more
Streptomyces ipomoeae 91-03 ECF38 ECF38s2

>ECFp26759 ECF38 ECF38s2 Streptomyces ipomoeae 91-03

1 MGTVVDDAASVEFHAFFERHYAELSRLAHLLTGEADAADDLAADALLAMW
51 HRWDRVRAAEHPVAYARGVVANLARTRIRSAVRERRRITLFWSQREEKTE
101 NPDVPGVVDVQSALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQKLFGTQDAPRRMHAGITGGGVRGASVTGAGAPGSGGRDR

>ECFp26761 ECF38 ECF38s2 Streptomyces thermolilacinus SPC6

1 MGTSTDDATTEFHEFFERHYAELARLAHLLTGEADAADDLAADALLALWH
51 RWDRVRAAQHPVAYARGVVANLARSRVRSAVRERRRIALFWSQRSEHTEG
101 PDVPAVVDVRDALRRLPFRKRACVVLRHAFDLSERETALTLGVSVGTVKS
151 QTSKAMAQLQQLLGTRAAASELVGGRK

>ECFp26777 ECF38 ECF38s2 Streptomyces sp. NTK 937

1 MGTVVDDAAAAEFHAFFEAHYAELARLARLLTGEADAADDLAADALTALW
51 HRWDRVRGADHPVAYARGVVANLARTRIRSAVRERRRIALFWAPRGGGDG
101 YAVEDPDVSAVVDVQGALRRLPFGKRACVVLRHAFDLSERDTSLVLGISV
151 GTVKSQTSRAMAELHRLLGPEGPAVRVQVAAAAQRTGGRR

>ECFp26779 ECF38 ECF38s2 Streptomyces viridochromogenes

1 MGTVVDDAASVEFHAFFERHYAELSRLAHLLTGEADAADDLAADALLALW
51 HRWDRVRAADHPVAYARGVVANLARTRIRSAVRERRRVALFWSQGEEKAE
101 NPDVAGVVDVQGALRRLPFRKRACVVLRHAFDLSEKDTALALGISVGTVK
151 SQTSKGMAELQRLLGTQGAPLKVHAAAMARTGDAGGRNR

>ECFp26780 ECF38 ECF38s2 Streptomyces

1 MGTVVDDAASVEFHAFFERHYAELSRLAHLLTGEADAADDLAADALLAMW
51 HRWDRVRAADHPVAYARGVVANLARTRIRSAVRERRRITLFWSQREEKTE
101 NPDVPGVVDVQSALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQKLLGTEGTPRRMHAGITGGGVPGARVTGAGAPGSGGRDR

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more