ECF proteins of ECF subgroup ECF38s2

Displaying ECF 1 - 20 of 393 in total
Name Aliases LCA Taxa Group Subgroup
ECFp112913
  • RNA polymerase subunit sigma
  • IF12_RS0116820
Glycomyces sp. NRRL B-16210 ECF38 ECF38s2

>ECFp112913 ECF38 ECF38s2 Glycomyces sp. NRRL B-16210

1 MEEEAFRAFFERHHAELARFAWLLIGERTAAEDLASDAMLAVWRQWDQAR
51 RARSQIAYARGIVANLAKSRIRAAVRERRRNTLFWQRPGEAADGPDAAAM
101 VDVRAALAMLPLRRRACVILRHSLDLSERETAEALGVSIGTVKSQTSRGL
151 ADLRRILGPQGGEGSAWAAIRNGVQW

>ECFp26602 ECF38 ECF38s2 Streptomyces griseoplanus

1 MGGHGGRAEIPQDTADAREFHDFFERHHAELSRLAYLLTGDPDSADDLAA
51 DALVEVWRHWDRVRAAERPAAYARGVVTNLARNRIRSLTRERHRVGVVAA
101 LWRDRSDDPDVPAVVDVRTALDRLPFRKRACVVLRHAFDLSEQETARVLG
151 ISVGTVKSQTSRGAAQLEALLRPGSTGAPYDAREPAVGRPLGGGAPAAQR
201 RAPPRRRGRRSVATVGGNREEE

Name Aliases LCA Taxa Group Subgroup
ECFp27064
  • Putative RNA polymerase ECF-subfamily sigma factor
  • FRAAL6604
Frankia alni ACN14a ECF38 ECF38s2

>ECFp27064 ECF38 ECF38s2 Frankia alni ACN14a

1 MPVEAVAADDEHEHPHRQAEFHAFFESHHRALSRFAYLLTGDHDAADDLT
51 AEALTAAWSNWDRVRSAELPLAYVRRIVANLAADRVRRVVRERRGLAVLG
101 QRAERSAPVPDVPAVVDLRTALMSLPSGKRACVVLRYAFDLSEGETARTL
151 GISVGTVKSQTAKGVAELERILKRAEPPPTATTQQEVTPRMAPEHPATPP
201 GGTSRPGESRMHGARSGSAESLGGHGTDQSDEPAGPDRSTFAPPRGTEPT
251 PGPELTPRAGLTPGAELTPGAELTPGPGRVPGAGRHPGGDPFPETGRKLG
301 AAPLARREPLRREPVPRRGSGLGHPPLAWREHVPERVPGPDHIPGPERIP
351 DPDHVSGPDHVSGPEPVPGAERVTGFECVTGPERLTGAEHVTLAEHASQA
401 VHASQAEHVTLAEHVTRLDEPGWLERPGGAGSPTWPGSLPWPRLAWPERL
451 AWPVWRVGEA

>ECFp139809 ECF38 ECF38s2 Streptomyces harbinensis

1 MLHGLSNRDGSAGVRVRNTKEAGVADPSDGFSAEFDAFFERHHAELARLA
51 HLLLGGRDSAESADDLAADALVAIWHRWERVRAADRPIAYARGVVANMAR
101 SSIRSRTRERRRIALFWSQHSTHTEGPDVPAVLDVRAALDRLPYRKRACV
151 VLRHAFDLSERETARALGISVGTVKSQTSRGIAELERLLTPGAATGPGKT
201 GTGADAAAGADATLRVLRTGPVERSSG

Name Aliases LCA Taxa Group Subgroup
ECFp26565
Frankia sp. ACN1ag ECF38 ECF38s2

>ECFp26565 ECF38 ECF38s2 Frankia sp. ACN1ag

1 MEAVAADDEHEHPHRQAEFHAFFESHHRALSRFAYLLTGDHDAADDLTAE
51 ALTAAWSSWDRVRSAELPLAYVRRIVANLAADRVRKVVRERRGLAVLGQR
101 AERSAPVPDVPAVVDLRTALMSLPSGKRACVVLRYAFDLSEGETARTLGI
151 SVGTVKSQTAKGVAELERILKRAEPPPTATTQEEVTPRMAPEHPETPQGG
201 TSRPGTSRMNGARSGSGDSPGGRGAGQSDEPAGPDRSAFAPPRGTEPTPG
251 TGLTRGTGLTAAPDLTPGADLTPGAGPTPGSGRHPHGEPFPETGRLPGPV
301 PLARREPLRREPVPWRGSASGRQPLSRHERVPGPERVPGPERVPGPERVP
351 GPERVPGPERLSPTERMPQAERMPPTEHVARLDEPGWLERPRGADSPTWP
401 ESLPWLRLAWPERLAWPVWRVGEA

>ECFp27131 ECF38 ECF38s2 Streptomyces

1 MNTPRSAAPAGPAPATGDASAEFHAFFERHHAELARLAHLLTGEADAADD
51 LAADALLALWHRWDRVRGAEHPVAYARGVVANMARGRIRSTVRERRRIAL
101 FWSQRSEHTDGPDVAAVVDVRQALERLPFRKRACVVLRHAFDLSERDTAL
151 ALGISVGTVKSQTSRGMAELQRHLGTGAADDLSGRGK

Name Aliases LCA Taxa Group Subgroup
ECFp176740
Frankia sp. CcI49 ECF38 ECF38s2

>ECFp176740 ECF38 ECF38s2 Frankia sp. CcI49

1 MSVDSVAELGAHSPRLRTDHRPRWDPTLLDPTLLEAVPLEAAPPDWGAEL
51 LATSSDVVTQWGGDTEEPEPLPEHPADGSGHLAGQPNARHEFQIFFENHH
101 RELSRFAYLLTGDRDVADDLTADALTAAWSRWDRVSAADSPIAYVRRILA
151 NLATSRLRRMIRERRGLAVLGMMGDHAGQAREHADLPAAVDLRAALMALP
201 ARKRACVVLRYAFDLSEAETARILGVSVGTVKSQTSKAVTELERLLGARP
251 DLIPPHEAGRSVPQQEPPTTRSAAARRGGAPRSRRRVGGAVDPAAAARSA
301 LNRLREGEAHGRLRGSES

Name Aliases LCA Taxa Group Subgroup
ECFp26461
Frankia sp. EUN1f ECF38 ECF38s2

>ECFp26461 ECF38 ECF38s2 Frankia sp. EUN1f

1 MSVDSVAELGAHSPQLRTDRRPRWDPTLLDPTLLEAVPLEAAPQDWGVEL
51 LATGSDVVTRWGGDTEEPEPLPEHPADGSGHLAGQPNARNEFQIFFENHH
101 RELSRFAYLLTGDRDVADDLTADALTAAWSRWDRVSAADSPIAYVRRILA
151 NLATSRLRRMIRERRGLAVLGMMGDHAGQAREHADLPAAVDLRAALMALP
201 ARKRACVVLRYAFDLSEAETARILGVSVGTVKSQTSKAVTELERLLGARP
251 DLSPPHEAGRSVPQQEPPTTRSAAARRGGAPRSRRRVGGAVDPAAAARSA
301 LNRLREGEAHGRLRGSES

>ECFp26404 ECF38 ECF38s2 Streptomyces violaceusniger

1 MNAPADDAAAAGTARAPGTPEDPDGLSADAHTGPQPNPHTADPQAEFRDF
51 FERHHAELARLAHLLLGSSDGADDLAADALVAVWHQWDRVRAADHPAAYA
101 RGVVANLARSRIRSLVRERRRVALFSSQRSDHVDDPDVSAVVDVQAALVR
151 LPFRKRACVVLRHAFDLSERETARTLGISVGTVKSQTSRGIAELERLLGP
201 PDGEGELSGATEAEQTVRTLRSGNTGHTGHTGPARHSGHMGHAGHAGGGS

>ECFp26422 ECF38 ECF38s2 Streptomyces

1 MADDASAEFHDFFDRHYAELARLAHLLTGEAAAADDLAADALVALWDRWD
51 RVRAAEHPVAYARGVVANMARSRIRAAVRERHRVALFWSRRGDPAEGPDV
101 AAVLDVRQALGKLPFRKRACVVLRHAFDLSERDTALALGISVGTVKSQTS
151 KGMAELERLLGGRTSLELAGRGER

Name Aliases LCA Taxa Group Subgroup
ECFp26444
  • ECF subfamily RNA polymerase sigma-24 subunit
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Frankia symbiont of Datisca glomerata ECF38 ECF38s2

>ECFp26444 ECF38 ECF38s2 Frankia symbiont of Datisca glomerata

1 MERDGDTIEAGGAVGTSVVPADPVSPDAPVAPDDPVAPDGHVGDRAPTRP
51 AAVDGGPDDHDDHDGPAAEFHDFFERHHRQLSRLAYLLTNDHDAADDITA
101 DAFTAAWRRWDRVRQADSPLAYLRRTVANMAASRLRRIVRERHGLGILGS
151 LAETRSTDTDVPAVVDVRTALMSLSTGKRECLVLRYAFDLSEDETARTLG
201 ISVGTVKSQTSKGAGELERVLLAGTRDNARGSARGPQAPPAADPVARLGR
251 KHPEARKGLPRRRRDVDPRARLRGGEAT

>ECFp26501 ECF38 ECF38s2 Streptomyces jeddahensis

1 MGTAVDDPAAEFHAFFENHYAELARLAYLLTGEPDAADDLAADALLALWH
51 HWDRVRAAEHPVAYARGVVTNLARTRIRSAVRERRRIALFWSHRDERTEN
101 PDVSAVVDVQAALRRLPFRKRACVVLRHAFDLSEKDTALALGISVGTVKS
151 QTSKAMAELERSLGAVDAPRRMQTAATAPRLTRPAGGRD

Name Aliases LCA Taxa Group Subgroup
ECFp26528
  • RNA polymerase subunit sigma
  • BGK67_16265
Streptomyces subrutilus ECF38 ECF38s2

>ECFp26528 ECF38 ECF38s2 Streptomyces subrutilus

1 MVLDDASAEFHDFFERHYAELARFAHLLTGGADGADDLAADALIALWQRW
51 DRLRQAEYPLAYARGVVANLARSRIRSAVRERRRIALFWSRGAEPLDGPD
101 VAAVVDVRTALARLPFRKRACVVLRHAFDLSEKDTALALGISVGTVKSQT
151 SKGMAELERMLGSTGAAGELLAGRRSR

Name Aliases LCA Taxa Group Subgroup
ECFp26524
  • RNA polymerase sigma factor
  • SXIM_08320
  • ... more
Streptomyces ECF38 ECF38s2

>ECFp26524 ECF38 ECF38s2 Streptomyces

1 MADPSEDFSAEFDAFFERHHAELARLAHLLLGGPDGAESADDLAADALVA
51 IWHRWERVRAADRPIAYARGVVANMARSRIRSRTRERRRIALFWSQHSTH
101 TNGPDVPAVLDVRAALGRLPYRKRACVVLRHAFDLSERETARTLGISVGT
151 VKSQTSRGIAELERLLTPGEAGRGEGGGPPLRALRTGPVERSS

>ECFp26564 ECF38 ECF38s2 Streptomyces sp. 351MFTsu5.1

1 MGTVVDDDASVEFHAFFERHYAELSRLAHLLTGESDAADDLAADALLALW
51 HRWDRVRAADHPAAYARGVVANLARTRIRGTVRERRRIALFWPQREEKAE
101 NPDVAGVVDVREALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGVQDAPLRMRAAMARTGEAGGRDR

>ECFp26580 ECF38 ECF38s2 Streptomyces lincolnensis

1 MGTVVDDAASVEFHAFFERHYAELSRLAHLLTGEPDAADDLAADALLALW
51 HRWDRVRAADHPAAYARGVVANLARTRIRSAVRERRRVALFWSQREEKTE
101 NPDVAGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGISVGTVK
151 SQTSKGMAELQRLLGTQAVPQKVHAAMARTADAGGRDR

Name Aliases LCA Taxa Group Subgroup
ECFp26706
Frankia ECF38 ECF38s2

>ECFp26706 ECF38 ECF38s2 Frankia

1 MERDGDTIEAGGAAGTSVVPADPVSPDAPVAPDDPVVPDGHVGDRARTRP
51 AAVDGGPDGHDDPCTPHGPDSHGDPGGPGGPAAEFHAFFERHHRQLSRLA
101 YLLTNDHDAADDITADAFTAAWRRWDRVRQADSPLAYLRRTVANMAASRL
151 RRIMRERHGLGILGSLAETRSTDTDVPAVVDVRTALMSLAAGKRECLVLR
201 YAFDLSEDETARTLGISVGTVKSQTSKGAGELERILLAGTRDNARGSARG
251 PQAPPAADPVARLGRKHPEARKGLPRRRRDVDPRARLRGGEAT

>ECFp26720 ECF38 ECF38s2 Streptomyces

1 MGTVVDDAASVEFHAFFERHYAELSRLAYLLTGESDTADDLAADALLALW
51 HRWDRVRAADHPAAYARGVVANLARTRIRSAVRERRRIALFWSQREENTE
101 NPDVAGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGTQGVPQRMHAAVGAPRCAPAVEGLRTGEGGGRDR

>ECFp26810 ECF38 ECF38s2 Streptacidiphilus carbonis

1 MAFGTTTPRNATAEAAFHAFFEQRHRELSRLAYLLTGEADAADDLAADAL
51 LEVWKHWERVSTADSPAAYARGVVANLCRNRIRRLTRERAGLRGWGALWR
101 DRESVEGADVPAVVDVRGALRRLPHRRRACVVLRYAFDLSERETAQALGI
151 SVGTVKSQTSRGAAQLAELLAGWPEAQWLVAAGEEG

>ECFp26806 ECF38 ECF38s2 Streptomyces

1 MGTVVDDAASEEFHAFFERHYAELSRLAHLLTGEADAADDLAADALLALW
51 HRWDRVRAADHPAAYARGVVANLARTRIRSAVRERRRVALFWSQREEKTE
101 NPDVAGVVDVQEALRRLPFRKRACVVLRHAFDLSEKDTALALGVSVGTVK
151 SQTSKGMAELQRLLGPQSPPLRMHAALARGGESGGRTR

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more